KEGG   Xylella fastidiosa Hib4: XFHB_12565
Entry
XFHB_12565        CDS       T04925                                 

Definition
(GenBank) glutamate synthase
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
xfh  Xylella fastidiosa Hib4
Pathway
xfh00250  Alanine, aspartate and glutamate metabolism
xfh00910  Nitrogen metabolism
xfh01100  Metabolic pathways
xfh01110  Biosynthesis of secondary metabolites
xfh01120  Microbial metabolism in diverse environments
xfh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xfh00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    XFHB_12565
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XFHB_12565
Enzymes [BR:xfh01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     XFHB_12565
SSDB
Motif
Pfam: Fer4_20 Pyr_redox_2 Pyr_redox Pyr_redox_3 NAD_binding_8 2-Hacid_dh_C NAD_binding_7 HI0933_like F420_oxidored FAD_binding_3 FAD_oxidored Thi4 GIDA FAD_binding_2 DAO AlaDh_PNT_C 3HCDH_N Amino_oxidase FMO-like NAD_binding_9 zf-HIT Lycopene_cycl ThiF
Other DBs
NCBI-ProteinID: ALR07545
UniProt: A0A1L2B3N0
LinkDB
Position
complement(2728288..2729772)
AA seq 494 aa
MSRKHAFQFLDLPRQMPQRIPVELRTSGDWRELYGKFDKAEAQYQAGRCLDCGNPYCSWK
CPVHNAIPQWLQLVQENRIDEAAALCHATNPLPEVCGRVCPQDRLCEGSCTLEEFGAVTI
GAVEKYIVDTALQQGWRPDLSHVQPTGWRVAVVGAGPAGLACADRLARAGVQAVVYDRYE
QIGGLLQFGIPSFKLDKAVMSTRRKVLEGMGVEFRLGVEIGKDLGIEALLEDYDAVFLGV
GAYRYTDGGLPGQDLKNVLPALPFLVQNGRIVSGNDPYGRPIAGWEDQVQLPDVTGKSVV
VLGGGDTGMDCVRSAIRLGATKVTCIYRRDEANMPGSAREVANAREEGVRFLFNRQPLSI
QSGTDKQAIGVTVVETKLAEPDANGRRNAVPIQGTEAVLEADVVIIAFGFSPMLPEWLTA
QGIQASSNGRIVVALSDTGDGLTYQTTHPKLFAGGDCVRGADLVVTAVAEGRDAAESIVR
WLRATAQVMDVAVI
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgagtcgcaagcacgctttccaatttctcgatttgcctcggcagatgcctcaacgcatc
ccggtggagctgcgtacttccggggattggcgggagttatacggtaagttcgataaggcc
gaagcgcagtaccaagccggtcgctgtttggactgcggtaatccatattgcagttggaag
tgtccggtgcataacgccatcccgcagtggttgcagttagtgcaggaaaatcgcattgat
gaggccgcagcgttgtgccatgcaaccaacccgcttcctgaagtgtgcggtcgggtgtgt
ccgcaggaccgtctctgtgaaggcagttgcacgctggaggagtttggtgcggttaccatc
ggtgcggtggaaaagtacattgtggataccgcgttgcagcaggggtggcgtcccgatttg
agccatgtgcaaccgacgggttggcgcgtggcggtggtcggtgcagggcctgccggcctt
gcctgtgcggatcggttggcgcgtgctggggtccaggcggtggtgtatgaccgctatgag
cagatcggggggttgctgcagttcgggattcccagttttaagcttgataaggcggtgatg
agtacgcgccgcaaagtgcttgagggcatgggcgtagagtttcgattgggtgtggagatt
ggaaaggatctggggattgaagcgttgctggaggactacgatgcagtgttccttggcgtc
ggtgcgtatcgctacacggacggtggcttgccgggtcaggacttgaaaaacgtgttgccg
gcattaccgtttttggttcagaacggacgtatcgtttctggcaatgatccgtatggccgt
ccgattgccggttgggaggatcaggtgcagttgccggatgtgacggggaagtctgtggtt
gtactcggtggcggtgataccggcatggattgtgtacggagtgcgatccgtttaggtgca
actaaagtcacctgtatctatcggcgtgatgaagcgaatatgcctggttcggcgcgcgag
gttgctaacgcgcgggaagagggggtgcgctttctgttcaatcgtcagccattgtcgatt
caatccggtaccgacaaacaagccattggtgtcactgtggtggaaacgaagcttgccgag
ccggatgccaatggtcgtcgcaacgcagtgcctatccagggcactgaagcggtgctggaa
gcggatgtggtgattatcgctttcggtttctcgccgatgttgccggagtggttaactgcg
cagggtatacaagcgtcgagcaacggtcgcattgtggtggcgttgtctgatactggcgat
ggactgacctatcagacaacgcatccgaagttgtttgctggtggtgattgtgtgcgtggt
gccgatttagttgtcactgccgtggccgaagggcgcgacgcggctgagagcattgtgcgg
tggttgcgtgcgacggcacaggtgatggatgttgcggtgatctga

DBGET integrated database retrieval system