Xylella fastidiosa MUL0034: P303_00395 Help Entry P303_00395        CDS       T03317                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xfl  Xylella fastidiosa MUL0034 Pathway xfl01100   Metabolic pathways xfl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xfl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P303_00395   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P303_00395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIC13493 UniProt:  A0A060HD48 LinkDB All DBs Position 48443..48712 Genome browser AA seq 89 aa AA seqDB search MSVQTSAECELAELIVESLNLEDVQSGEIDPEAPLFNTGLGLDSIDALELALAITKRYGF QMRSDNDDNQRIFASLRALSDHVQAHRRT NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgtgcaaacttccgctgagtgcgaactggctgagttaattgtggaaagtctcaat cttgaggatgtccagtctggggagattgatccggaagcgccgttgtttaacacggggctg ggcttggattcgattgacgcgttggaattggctctggcgattaccaagcgttatggtttc cagatgcgttcggacaatgatgacaaccaacgtatctttgcttcgctgcgtgcgctttca gatcatgttcaagcgcacagaagaacctga

DBGET integrated database retrieval system