KEGG   Xylella fastidiosa MUL0034: P303_03675Help
Entry
P303_03675        CDS       T03317                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xfl  Xylella fastidiosa MUL0034
Brite
KEGG Orthology (KO) [BR:xfl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    P303_03675
Enzymes [BR:xfl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     P303_03675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 Thi4 Glutaredoxin DAO FAD_binding_3 FMO-like K_oxygenase AlaDh_PNT_C NAD_binding_8 Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AIC12303
UniProt: A0A060H9P9
LinkDB All DBs
Position
761369..762964
Genome map
AA seq 531 aa AA seqDB search
MFDESLKAQLKAYLDRVIRSIHIHASVDESHKSREMLDLLENIVLLSGKKVVLDVHRDDD
QRKPSFGLSTPGESISIRFAGLPMGHEFASLVLGLLQVGGHPPKVADDLIERVRNLDGHY
RFETYFSVSCQSCPDVVQALNMAAVLNPQIEHVAIDGALFQDEVEARQIMSVPTVYLNGE
LFGQGRMTLEQIVAKLDSGAAKRTAESIQAKAVFDVLVVGAGPAGVAAAVYAARKGVRTG
LVAERFGGQVLDTMTIENFISVPETDGPRMAAALEQHVRQYEVDIMNLQRVETLVPAGEN
GFIEVRLASGASLSSLTVILSTGARWRQMNVPGEDEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIASYVTLLEFDTKLRADEVLQRKLRSMSNVEVIMGAQTTEVRGD
GKKVTGLVYVDRSTGGSFILALEGVFVQIGLLPNTEWLKGRVELSPRGEIVVDERGHTSL
PGVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRNVVEITGIAQAQAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgaaagtttgaaggctcagctgaaagcctatttggatcgggtgattcgctcc
attcatattcatgcttctgtcgacgagagtcacaagtcgcgtgagatgctcgatttactc
gaaaatattgtgctgctttcgggcaagaaggtcgttctggatgtgcatcgtgacgatgat
cagcgaaagccatcctttgggttgagtactccaggagagagtatttcgatacgttttgct
ggtttgccgatggggcacgagtttgcttcattggtgcttgggttgttacaggttggtggg
catcctcctaaagtggctgatgatcttattgagcgggtacgtaacctggatggtcattat
cgttttgagacctatttttcagtttcttgtcagagttgcccggatgtggtgcaggcactg
aatatggctgcggtgttgaatccgcagattgagcatgtggctattgacggtgcattgttc
caggatgaggttgaggcgcgccagattatgtcagtaccaacggtgtatttgaatggcgag
ctgtttggtcaggggcgtatgacgttggaacagattgttgccaagcttgatagtggtgcg
gccaagcgcacagccgagagtatccaggctaaggctgtttttgacgtgttggtggttggt
gccggtccggctggtgttgcagcggcggtatatgctgcgcgcaagggggtccggacgggt
ttggtcgctgagcgctttggtggccaagtgttggataccatgacgatcgagaacttcata
tctgttccggaaactgatggcccgaggatggctgcggcgctggagcagcatgtgcgtcag
tatgaggtcgatatcatgaatttgcagcgtgtcgagacgttggtaccggctggagagaac
ggctttatcgaggtcagattggccagtggtgcgtcgctgagcagcctcaccgtgattctc
tctacgggtgcacgttggcgtcagatgaatgtgcctggtgaggatgagtatcgaaacaag
ggggttgcttattgtccgcattgtgatggcccgttgttcaagggtaagcgtgtcgcggtg
attggcggtggtaattcgggagtcgaggcagcgatcgatttggctggaattgcttcatat
gtcacgttgcttgagttcgataccaagctgcgtgccgacgaagtattgcaacgcaagcta
cgcagtatgtcgaatgtggaagtcatcatgggtgcccagaccaccgaggtacgtggtgat
ggaaagaaggtgactggtttggtctatgttgatcgcagtactggtggaagctttatattg
gcgttggaaggagtgtttgtgcagatcggtctgttacccaataccgagtggttgaaaggt
agggtggaattgtctccccgtggagaaattgtcgttgatgaacgtggtcataccagctta
ccaggtgtgttcgctgctggtgatgcgaccacggtgccgtataagcagattgttattgcg
atgggggagggatctaaagccgcgttgagtgctttcgattatctgattcgtaatgtggtt
gaaattactggaattgctcaggcacaggcagcgtga

DBGET integrated database retrieval system