KEGG   Xylella fastidiosa MUL0034: P303_10345Help
Entry
P303_10345        CDS       T03317                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
xfl  Xylella fastidiosa MUL0034
Pathway
xfl00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:xfl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    P303_10345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xfl01003]
    P303_10345
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xfl01011]
    P303_10345
Enzymes [BR:xfl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     P303_10345
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     P303_10345
Glycosyltransferases [BR:xfl01003]
 Polysaccharide
  Bacterial polysaccharide
   P303_10345
Peptidoglycan biosynthesis and degradation proteins [BR:xfl01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   P303_10345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AIC13130
UniProt: A0A060HCU2
LinkDB All DBs
Position
2044364..2046790
Genome map
AA seq 808 aa AA seqDB search
MAYHAEDDFNEASNGNMLGHSPWWGWLIACALAGLALAMGFLVPYTLYLNQQVTARFGEL
RWQIPTRVYARPLMLQPGMALDARTLKIELDAASYREDNHGELPGTYQQQNGRFTVSSRG
YVDVDGAIPASRLIITLNNNQVSALRNADTRKPIRRGRLDPARIATLYGQKQEERRLVRL
EEVPQLLVTGLQVVEDRDFKHHHGIDITSILRAAWVMVRSGGGVRQGASTLTQQLARSGL
LGIGKEQTLQRKCNEILYALILEARYSKRVILESYLNQVYLGQRGSQAVHGVATGAEFWY
GRELGSLTTEQVALLIGLVKGPSYYDPRRFPDRALSRRNFVLGKLHENKLIDDAEYMRAQ
ASPLGVPKEPGLVAANRFVAYLDLVRRQLAHDYPENVLRGAGMTVLTGMSPSAQAYAERG
VQTTLSALEKVKGLKRPPLQAGLVLTDVHNGDVLAVVGSRDATQSGFNRAIEAQRQVGSL
LKPFVYLLALASPDRWSLSSWVEDTPVNIPLAHGRIWSPSNSDNISHGTVRLIDALAHSY
NQATVRVGMQVGPERVAQLINVLAGLKADANPSLILGATDQSPYAMTQLYQFLASGGEIQ
PLHAVRGVLDPQNKLLKRYDNTPAPAQPGDSVAANVISVALQEVVNSGTARQLIIDGLGR
LSPAGKTGTSNDGRDSWYAGYTGNHLAVIWVGNDQNEQTGLYGATGAMRVWSSIFSQLPS
TRLQVNGKGLDWQSVEPMGTGTTDANCPGARRFPFVTGFAPPYAACSGAGGAPEAGHNIG
WRNWFGLDKQKGDQASPPITPPPDQSTQ
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
gtggcataccacgcagaagatgatttcaacgaagcgtcaaatggcaacatgctgggccat
tccccctggtggggctggctgatcgcttgcgccttggcaggcttggcgcttgccatgggc
tttctggtcccttacacgctttacctgaatcagcaggtgaccgctcgctttggtgagctg
cgctggcagatcccaacccgggtctatgctcgccctttgatgctacaaccgggcatggca
ttagatgcgcgcacgttgaagatcgaactggatgctgcatcctatcgtgaggacaatcac
ggcgagttaccaggcacttaccaacaacaaaatggccgattcactgtctccagccgtggc
tacgttgatgtggatggtgcaataccagcaagccgtctgatcatcacgctgaacaacaac
caagtgtctgcactgcggaatgcagatacacgtaaaccaatcaggcgcgggcgactggat
ccagcacggatcgccacactgtacggccagaagcaggaagaacgccgtttggtcaggttg
gaggaagttccccaactgctcgtcaccggcttacaagtggtggaagaccgcgatttcaaa
catcaccacggcatcgacatcaccagcattttgcgcgcagcctgggtgatggtgcgttca
ggcggtggcgttcgccaaggtgccagtaccctaacgcaacagctggcgcgtagcggactg
cttggtatcggcaaagaacagacgttgcagcgcaaatgcaacgaaatcctgtatgcactg
atcctggaggcacgctactccaagcgcgttatcctggagtcctatctcaatcaagtctac
ctgggtcaacgtggcagccaggctgtacatggtgtcgcaactggcgcggagttctggtat
ggacgtgagctaggctcgctcactactgagcaggtcgccctgctcatcggactggtcaaa
ggaccttcgtactacgatccacgccgtttccctgatcgcgcattgtcccgacgcaatttc
gtgcttggcaaactgcatgaaaacaaactgatcgacgatgctgaatacatgcgcgcccaa
gcatcgcccctaggtgtccccaaagaacctggcctggttgcagccaaccgcttcgtcgcg
tacctggacctggtacgccgccagcttgctcacgattacccagagaatgtgttgcgtggc
gcaggcatgaccgtacttaccggcatgtcgccctcagcacaagcctatgctgagagagga
gtacaaaccacgctcagtgcactggaaaaggtcaaggggctgaaacgtccgccactgcaa
gccggactggtactgacggacgtgcataacggcgatgtcctggccgtggtcggtagtcgc
gatgcaacccaatcgggtttcaatcgtgccattgaagcgcaacgccaggtgggttcgctg
ctgaaaccgttcgtctatctactagcactggcctcaccggatcgttggtccttgtccagt
tgggtagaagacaccccggtcaacataccgctggcacatggacgcatttggtcgccaagc
aactcagacaacatcagccacggaaccgtgcgcttgattgatgcattggcgcactcttac
aaccaagcaacagtgcgcgttggcatgcaggtcggcccagaacgtgtggctcaattgatt
aacgttttggccggattaaaagccgacgccaacccatcgctgatcctgggcgcaaccgac
caaagcccttatgcaatgacgcagctctatcagttcctggcttctgggggtgaaatccaa
ccattgcacgcagtgcgcggcgtactcgatccgcaaaacaaactgctcaaacgctatgac
aataccccggcacctgcacagcccggcgactcagtcgcagccaacgtcatcagcgttgcg
ctacaggaagtggtcaacagcggtaccgcgcggcaactcatcattgatggcttgggtcgg
ctgtcccctgccggcaaaaccggaacctccaacgatggacgtgacagctggtacgcgggc
tataccgggaaccacttggctgtcatttgggtcggcaacgaccaaaacgagcaaactggc
ctatacggtgccaccggtgccatgcgcgtctggtcgagcatcttctcgcagttaccaagc
accagattacaagtcaacggcaaaggactggattggcaatcagtcgagcctatgggcact
ggcaccacagacgcaaactgcccaggcgcacgccgctttccgtttgtaaccggcttcgct
ccgccttatgcagcatgctctggtgctggcggagcacccgaagctgggcataatatcggc
tggcgtaactggttcgggctggataagcagaagggggaccaagcatcgccccccataacg
cctcctcccgatcaatcgacacaatga

DBGET integrated database retrieval system