KEGG   Xylella fastidiosa MUL0034: P303_11595Help
Entry
P303_11595        CDS       T03317                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
xfl  Xylella fastidiosa MUL0034
Pathway
xfl00790  Folate biosynthesis
xfl01100  Metabolic pathways
Module
xfl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xfl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    P303_11595
Enzymes [BR:xfl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     P303_11595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AIC13307
UniProt: A0A060HJR0
LinkDB All DBs
Position
2321953..2322849
Genome map
AA seq 298 aa AA seqDB search
MFDTIPTLHCAGRTLRLDSPLVMGILNVTPDSFSDGGLYDSVDAAVAHGLRLIAEGADII
DIGGESTRPGAAPVPLEEELLRVVPVIKALTAYDKAVISVDTFKPEVMRAAVAAGAGLIN
DIYALRTPGALEAAAELAVPVILMHMKGEPHSTQTPQYDHVVDEVYRFLAERIFAAEIAG
IERHRLLIDPGFSFSKTTEHNIALLAALERFTNLGIPLLAGLSRKRSLGELTGRQLPIER
VYASVAAHLIAVQRGALIVRVHDVAAMVDALKVWQAVSAAAAPATHTKTTVARSPHDD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacactatccccaccctgcactgcgccggacgcaccttgcggctagacagtcca
ttggtcatgggtatcctcaacgtgactcctgattctttttccgacggaggcctgtatgac
tctgtggatgcagcagtggcgcatggattacgtctgattgctgagggtgcagacatcatt
gatattggcggggaatccacccgtcccggcgcagccccggtaccgctggaggaggaacta
ctccgagtggtgccggtcatcaaggcattaactgcctacgataaagctgtcatcagcgta
gacaccttcaaacctgaggtaatgcgtgcggcagtcgcggccggtgccggcttgatcaat
gacatctatgcactacgcactcccggagcgctggaagcagcagcagaattggctgtacca
gtaatattgatgcatatgaaaggtgagccgcactcaacgcaaacaccacagtacgatcat
gtggttgatgaagtgtaccgtttcctggccgagcggatttttgccgccgagatagcaggt
atcgaacgacaccgactgctgatcgatcctggtttcagtttcagcaagaccacggaacat
aacattgcactgttagcggcactggaacgtttcaccaatctcggcatcccattgttggcc
ggattgtcacgcaagcgtagcttgggcgaactgacaggacgtcagttaccaatcgaacgc
gtgtacgcctccgtcgctgcacatctcattgcggtacaacgcggcgcgttaatcgtacgg
gtgcatgatgtggcagctatggtcgatgccctcaaagtttggcaggcagtttcagcagcg
gctgcacctgcaacacataccaaaactacagtggctcgttcgccccatgacgactga

DBGET integrated database retrieval system