KEGG   Xylella fastidiosa M12: Xfasm12_0870Help
Entry
Xfasm12_0870      CDS       T00677                                 

Definition
(GenBank) subunit F of alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xfm  Xylella fastidiosa M12
Brite
KEGG Orthology (KO) [BR:xfm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Xfasm12_0870
Enzymes [BR:xfm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Xfasm12_0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 Thi4 DAO FAD_binding_3 Glutaredoxin AlaDh_PNT_C FMO-like K_oxygenase NAD_binding_8 DUF2597
Motif
Other DBs
NCBI-ProteinID: ACA11856
LinkDB All DBs
Position
943120..944715
Genome map
AA seq 531 aa AA seqDB search
MFDESLKAQLKAYLDRVIRSIHIHASVDESHKSREMLDLLENIVLLSGKKVVLEVHRDDD
QRKPSFGLSTPGESISIRFAGLPMGHEFASLVLGLLQVGGHPPKVADDLIERVRNLDGHY
RFETYFSVSCQSCPDVVQALNMAAVLNPQIEHVAIDGALFQDEVEVRQIMSVPTVYLNGE
LFGQGRMTLEQIVAKLDSGAAKRTAESIQDKAAFDVLVVGAGPAGAAAAVYAARKGVRTG
LVAERFGGQVLDTMTIENFISVPETDGPRMAAALEQHVRQYEVDIMNLQRVETLVPAGEN
GFIEVRLASGASLSSRTVILSTGARWRQMNVPGEDEYRNKGIAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIASYVTLLEFDTKLRADEVLQRKLRSMSNVEVIMGAQTTEVRGD
GKKVTGLVYVDRSTGGSFILALEGVFVQIGLLPNTEWLKGRVELSPRGEIVVDERGHTSL
PGVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRNVVEITGIAQAQAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgaaagtttgaaggctcagctgaaagcctatttggatcgagtgattcgctcc
attcatattcatgcttctgtcgacgagagtcacaagtcgcgtgagatgctcgatttgctc
gaaaatattgtgttgctttcgggcaagaaggtcgttctggaggtgcatcgtgacgatgat
cagcgcaagccatcctttgggttgagtacgccaggagagagtatttcgatacgttttgct
ggtttgccgatggggcacgagtttgcttcattggtgcttgggttgttacaggttggtggg
catcctcctaaagtggctgatgatcttattgagcgggtacgtaacctggatggtcattat
cgttttgagacctatttttcagtttcttgtcagagttgccctgatgtggtgcaggcactg
aatatggctgcggtgttgaatccgcagattgagcatgtggctattgacggtgcattgttc
caggatgaggttgaggtgcgccagattatgtcagtaccaacggtgtatttgaatggcgag
ctgtttggtcaggggcgtatgacgttggaacagattgttgccaagcttgatagtggtgcg
gccaagcgcacagccgagagtatccaggataaggctgcttttgacgtgttggtggttggt
gccggtccggctggtgctgcagcggcggtatatgctgcgcgcaagggggtccggacgggt
ttggtcgctgagcgctttggtggccaagtgttggataccatgacgatcgagaacttcata
tctgttccggaaactgatggcccgaggatggctgcggcgctggagcagcatgtgcgtcag
tatgaggtcgatatcatgaatttgcagcgtgtcgagacgttggtaccggctggagagaac
ggctttatcgaggtcagattggccagtggtgcgtcgctgagcagccgcaccgtgattctc
tctacgggtgcacgctggcgccagatgaatgtgcctggtgaggatgagtatcgcaacaag
gggattgcttattgtccgcattgcgatggcccgttgttcaagggtaagcgtgtcgcggtg
attggcggtggtaattcgggagtcgaggcagcgatcgacttggctggaattgcttcatat
gtcacgttgcttgagttcgataccaagctgcgtgccgacgaagtattgcaacgcaagcta
cgcagtatgtcgaatgtggaagtcatcatgggtgcccagaccaccgaggtacgtggtgat
ggaaagaaggtgactggtttggtctatgttgatcgcagtactggtggaagctttatattg
gcgttggaaggagtgtttgtgcagatcggtctgttacccaataccgagtggttgaaaggt
agggtggaattgtctccccgtggagaaattgtcgttgatgaacgtggtcataccagctta
ccaggtgtgttcgctgctggtgatgcgaccacggtgccgtataagcagattgttattgcg
atgggggagggatctaaagccgcgttgagtgctttcgattatctgattcgtaatgtggtt
gaaattactggaattgctcaggcacaggcagcgtga

DBGET integrated database retrieval system