KEGG   Xylella fastidiosa M12: Xfasm12_2046Help
Entry
Xfasm12_2046      CDS       T00677                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
xfm  Xylella fastidiosa M12
Pathway
xfm00473  D-Alanine metabolism
xfm00550  Peptidoglycan biosynthesis
xfm01100  Metabolic pathways
xfm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xfm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Xfasm12_2046
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Xfasm12_2046
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Xfasm12_2046
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xfm01011]
    Xfasm12_2046
Enzymes [BR:xfm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Xfasm12_2046
Peptidoglycan biosynthesis and degradation proteins [BR:xfm01011]
 Precursor biosynthesis
  Amino acid ligase
   Xfasm12_2046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACA12912
LinkDB All DBs
Position
complement(2145285..2146247)
Genome map
AA seq 320 aa AA seqDB search
MGMSIFSLFPRYTDPAVFGRVAVLLGGTSAEREVSLLSGRNVLEVLRMRGVDAQSVDGVP
ALAQALVERRFDRVFNVLHGHNGGGEDGVVQGLMQAFGVPYTGSDVLASALSMDKVRTKQ
VWLALGLPTPRYASLSVCATAVEVRKAVEMLGFPVIIKPAKEGSSVGVSRVFALEHLEEA
VALAARYEGELLMEQLIEGDELTVSILDEMALPSIRIVPQGQWYDYNAKYLAEDTQYVCP
GLDDVAEAEIAQLALAAFHGVGCRGWGRVDVMRERSSGRFFLLEVNTAPGMTTHSLVPKA
ASQLGMGFDDLVWRILEQTL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgagcatattttcactgtttccacggtatacggatccggcggtgtttggtcgt
gttgcagtgttattaggggggacgtctgctgagcgtgaggtgtctttgctttcaggtcgt
aatgtgttggaagtattgcgcatgcgcggtgttgatgctcagtcggtagatggggttccg
gcactcgctcaggcgctggtggaacggcgttttgatcgtgtgttcaatgtgttgcacggc
cataatggcggtggtgaggatggtgtggtgcaggggttgatgcaggcttttggtgtgccg
tatacaggttcggatgtgcttgcttcagcgttgagtatggataaggtgcgcactaaacag
gtttggcttgcgctgggtttgccgacgccgcgttatgcgagtttgagtgtgtgtgccact
gctgttgaggtgcgtaaggcggttgagatgctaggttttccggtgattattaagccggcc
aaagaagggtctagtgttggtgtcagtcgtgtgtttgcgctggagcatttggaggaggcg
gttgctttagcggcgcgttacgagggtgagttgctgatggagcagttgatcgaaggggat
gaattgacggtgtcgattcttgatgagatggcgttgccctcaattcggatcgttcctcag
gggcagtggtatgactataacgcgaagtatcttgctgaagacacgcagtatgtgtgcccg
ggtttggatgatgttgctgaggctgaaatcgctcaacttgcgttggctgcattccatggt
gttggttgtcgtggttggggtcgtgtggatgtgatgcgcgagcgcagcagtgggcgcttt
ttcttattggaagtcaatactgctcctgggatgacgactcactcgttagtgccgaaggca
gcgagtcagttgggtatgggttttgatgatttggtgtggcggattctggagcagacttta
tga

DBGET integrated database retrieval system