KEGG   Xylella fastidiosa M23: XfasM23_0287Help
Entry
XfasM23_0287      CDS       T00692                                 

Definition
(GenBank) acetylglutamate kinase
  KO
K22478  bifunctional N-acetylglutamate synthase/kinase [EC:2.3.1.1 2.7.2.8]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00220  Arginine biosynthesis
xfn01100  Metabolic pathways
xfn01110  Biosynthesis of secondary metabolites
xfn01130  Biosynthesis of antibiotics
xfn01210  2-Oxocarboxylic acid metabolism
xfn01230  Biosynthesis of amino acids
Module
xfn_M00028  Ornithine biosynthesis, glutamate => ornithine
xfn_M00845  Arginine biosynthesis, glutamate => acetylcitrulline => arginine
Brite
KEGG Orthology (KO) [BR:xfn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    XfasM23_0287
Enzymes [BR:xfn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     XfasM23_0287
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.8  acetylglutamate kinase
     XfasM23_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAT AA_kinase Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: ACB91736
UniProt: B2I7K8
LinkDB All DBs
Structure
PDB: 

Position
370277..371593
Genome map
AA seq 438 aa AA seqDB search
MHANLQTRQIIIRLLSSMASAKEISQYLKRFSQLDAKRFAVVKVGGAVLRDDVDALTSSL
SFLQEVGLTPIVLHGAGPQLDEELTAVGIQKKTVNGFRVTLPETMAIVRKVFHATNLQLI
EALQRNGARATSITGGVFEAHYLDQETYGLVGGISAVNIAPIEASLRAASIPVIASLGET
PSGQILNINADVAANELVHVLQPYKIIFLTGTGGLLDADGKIINSINLSTEYEQLIQQPW
VYGGMKLKIEQIKHLLDRLPLESSVSITRPADLAKELFTHKGSGTLIRRGERVIRATTWK
DLDLPRLQHLIQSSFRRTLIPHYFETTPLLRAYVSENYRAAVILTKLGNVPYLDKFAVLD
DAQGEGLGRAVWSIMREETPQLFWRSRHNNQANAFYYAESDGYYKQDHWKIFWNGLHHFQ
QIQQCVAHCTQHPPTLID
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccaacctacagactcgacagatcatcatccgcctgctgtcaagcatggcgagc
gccaaggaaattagccaatacctcaagcgattctcccaattggatgcaaaacgctttgct
gtcgtcaaagttggcggcgccgtactgcgcgatgatgtggacgcactgacctcctccctc
tcattcctccaagaggtgggactcaccccgattgtcctgcacggcgccggtccccaattg
gatgaagaactcactgctgtcggcattcaaaaaaagaccgtcaacggcttccgtgtcacc
ttgccagagacaatggccatcgtccgcaaagtgtttcatgccaccaacctccaactcatc
gaagcattacagcgcaacggcgcccgcgccacctccatcaccggcggagtatttgaagca
cactaccttgaccaagaaacctacggccttgtgggcggaatctccgccgtcaacatcgca
ccgattgaggccagcttgcgtgccgcctctattcccgtcattgccagcctcggcgaaact
cccagcggccaaattctcaacatcaatgccgatgttgccgccaatgaactcgtacacgtc
ctccagccctacaaaatcatctttctcaccggcacgggcggcttacttgatgccgatgga
aaaatcattaactcaatcaacctatccaccgaatacgaacaactcatccagcagccctgg
gtctatggcggcatgaaactcaagatcgaacagatcaaacacctcctggaccgactgccc
ctagaatcctcagtctccatcacccgccccgccgaccttgccaaagaactgtttacccac
aaaggctccggcaccctgatacgccgtggcgaacgagtcatccgcgccaccacatggaaa
gacctagacctcccgcgcctccaacacctcatccaatccagcttcaggcgtaccctgatc
ccccattacttcgaaaccacccccttactgcgcgcctatgtcagcgaaaactaccgcgct
gccgtgatcctgaccaagctgggtaacgtcccatacctagataaattcgccgtattggac
gacgcacagggagaaggcctcggccgtgccgtctggagcatcatgcgcgaagaaacaccc
caactcttctggcgttcccgccacaacaaccaagccaatgctttttactacgccgaatcc
gatggctactacaaacaagaccactggaaaatcttttggaatggcctacatcacttccaa
cagatccaacaatgcgtcgcccactgcacccaacatcccccaaccctgatcgattga

DBGET integrated database retrieval system