KEGG   Xylella fastidiosa M23: XfasM23_1387Help
Entry
XfasM23_1387      CDS       T00692                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00564  Glycerophospholipid metabolism
xfn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xfn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    XfasM23_1387
Enzymes [BR:xfn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     XfasM23_1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ACB92805
UniProt: B2I616
LinkDB All DBs
Position
1542013..1543536
Genome map
AA seq 507 aa AA seqDB search
MTIHNFDLLVVGGGINGTGIARDAAGRHLSVCLCEQHDLASHTSSASTKLIHGGLRYLEY
YEFALVSKALAEREILLRQAPHIVRPLHFILPHQPHLRPTWIIRAGLLLYDHLGFSRRTL
PRSRRLNLAQHPAGQPLKQELHTGFMYCDAQVQDARLVVLNAMDAAQRGARILTRTRCVR
TRRDGAHWLTELEDAQGRQQQIRTRAIVNAAGPWAVTFLDHIAQQPHQHTLRLVKGSHIV
VPRLFEHEHAYIFQQPDRRIVFAIPYEQHFTLIGTTDVDYVADPANPHIDAAETMYLCNA
VNSYFRQQITPEDVLWSYSGVRPLLNDGHNNASKVTRDYQLEILGNSAPLLNVFGGKLTT
YRKLSEEAVNQLCVALDHPYRAWTANGPPLPGGEHHDIAALQNTLRQHRPWLPTATAQRL
IHNYGTYAETLLGNATNLHTLGIHFGADLYQAEVDYLRTHEWACSAEDILWRRSKLGLHL
DAHGTQRLEDYLRSCSRIPDHADTTTQ
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcacaatttcgacctactggtggtcggtggcggtatcaacggcaccggcatt
gcccgtgatgccgccggacgtcacctctcagtgtgtctgtgcgaacaacacgacctggcc
tcccacacctccagcgccagcaccaaactgattcacggcgggctgcgctacttggaatat
tacgaatttgcgttagtcagcaaagcattggccgaacgcgaaatcttgctacgccaagca
ccgcacattgtcaggccactgcattttatcctcccgcaccaaccccatctgcgccccacc
tggataatccgcgcgggcttgctgctgtacgaccaccttggctttagtcgacgcaccctg
cctcgctcacgtcgcttgaacttggcccaacatcccgctgggcaaccactcaaacaggag
ctgcacaccggcttcatgtattgcgacgcccaggtccaagacgcacggctggtcgtgctg
aatgcaatggatgcagcacaacgtggcgcacgtatcctcacccgcacccgctgcgtgaga
acgcgccgtgacggcgcacattggttgactgaactggaagacgctcaaggaagacagcaa
caaattcgtacacgggccatcgtcaatgccgccggcccctgggccgtcacgtttctggat
cacatcgctcaacagccacatcagcacacactgcgtctggtgaaaggcagccacattgta
gtaccccgtctgtttgaacatgagcatgcctatatcttccaacaaccagacagacgcatc
gtctttgccattccttacgaacaacatttcacactgattggcactaccgacgtcgactac
gtagctgatccggcaaatccacacattgacgctgccgaaaccatgtacctgtgcaatgca
gtcaattcgtatttcagacaacaaatcacaccggaagacgtcctctggagctacagcgga
gtccgtcccctactgaacgatggacacaacaatgcatcgaaagtcactcgtgattaccaa
ttagaaatacttggaaacagcgcaccattactcaacgtgtttggtggcaaactcaccacc
tatcgcaagctttccgaagaagcagtgaaccagctatgcgtagcattggaccacccctac
cgtgcctggactgccaatgggccacccctgcctggcggcgaacaccacgacatcgcagcg
ctacaaaacacactgcgccaacaccgcccatggttacctactgccactgcgcaacgcctg
atacacaactacggcacctatgccgaaacgctgctcggcaatgccaccaacctacacacc
ctgggaattcactttggcgccgacctgtatcaagccgaagtagactacctgcgcacccac
gaatgggcatgcagtgccgaagacatcctctggcgccgcagcaaactcggcctgcattta
gatgcgcatggcacacagcgccttgaagactatctacgctcctgctcacgcatccctgat
cacgcggacacaacaacacaatga

DBGET integrated database retrieval system