KEGG   Xylella fastidiosa M23: XfasM23_1585Help
Entry
XfasM23_1585      CDS       T00692                                 

Definition
(GenBank) para-aminobenzoate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
xfn  Xylella fastidiosa M23
Pathway
xfn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xfn01100  Metabolic pathways
xfn01110  Biosynthesis of secondary metabolites
xfn01130  Biosynthesis of antibiotics
xfn01230  Biosynthesis of amino acids
xfn02024  Quorum sensing
Module
xfn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xfn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XfasM23_1585
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    XfasM23_1585
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    XfasM23_1585
Enzymes [BR:xfn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     XfasM23_1585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: ACB92993
UniProt: B2I712
LinkDB All DBs
Position
complement(1756099..1757457)
Genome map
AA seq 452 aa AA seqDB search
MTLIRFLRTDPDLLSMHRLAPERYPALFESTASGTQQSRWDVLLHTDGRFFRLDSDGVTR
DAQGRALSGDFLQVLDAVWSTEYVLRDTCEDAPPFRGGWALLLDYELAGQVEPVLKLPVR
TDGLPMALALRCPAAVLRDRHSGVFLIVAELGNEHLLDVIEADLAAVALLPPLPVWRSPV
AVTEDEPSQFIANAERVLDYLREGDVFQANISRLWEARFATALDPAALYMRLRVANPAPF
SGLFVAHGRAVVSSSPERLISVQGGRIQTRPIAGTRPRFVGEDDAARIRELVNHPKERAE
HVMLIDLERNDLGRVCVPGTVEVDELMTVESYAHVHHIVSNVRGWLPTGRTPGEIIRAVF
PGGTITGCPKVRCMQIIAQLEQVARGAYTGAFGWLNCDGDLDLNILIRTAEIDGVTVRFR
NGAGIVINSLPERELDETRAKATGVLRALHVI
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgacactcattcgatttctgcgtacggatccggatttattgtccatgcaccggttggca
ccggagcgttatccggcgctttttgaatctactgcttctggtactcagcagagtcgttgg
gatgtgttgttgcatacagatggtcgtttcttccgtttggattccgatggtgtaacacgc
gatgctcagggcagggcgctgtccggagactttttgcaggtattggatgcagtgtggagc
actgagtacgtgctgcgtgatacgtgtgaggatgctcctccattccgtggcggttgggct
ttacttcttgactatgaactggctgggcaggttgagccagtgttgaaattgccagtgcgt
actgatggtttgcctatggcgttagcattgcgttgtccggcagcggtattacgtgaccgc
cacagtggtgtttttttgattgtcgctgagctgggaaatgagcatttactggacgtgatt
gaggcggatttagctgctgttgccttgttgccgccattgccggtttggcgatctccagtg
gccgtgactgaggatgagccgtcgcagtttattgccaatgcagagcgtgtgctggattac
cttcgtgagggagacgtgttccaggcaaatatctcacgcctttgggaagctcgctttgcc
actgcacttgatccagcagcgttgtacatgcgtttgcgtgtagccaatcctgcgcctttc
tcgggattgtttgtggctcatggccgagctgtggtgagctcctcaccagagcggttgatt
tcggtgcaaggagggcgcattcagacgcgtccgattgctggtacccggccacgttttgtc
ggtgaagatgacgcagcacgcatccgcgaactggtgaatcaccctaaggagcgtgctgag
catgtgatgttgattgacttagagcgtaacgatttagggagagtgtgtgtgcctgggacc
gttgaggtcgatgagttgatgacggtggaaagctatgcgcatgtccatcatatcgtcagt
aatgtgcgtggctggttgcctacgggcaggaccccaggggagatcattcgcgccgtgttt
ccgggggggacaatcactggttgtccgaaggtgcgttgcatgcagatcattgcccagctc
gagcaggtggcacgcggtgcctacactggtgcctttggatggctcaattgtgatggtgat
ttggacctgaacattttaatccgcaccgctgagattgacggtgtgactgtacgtttccgt
aacggtgccggcatcgtgatcaattcactgcctgagcgtgagctggatgagacccgtgcc
aaggcgactggcgtactgcgcgccctgcatgtcatctga

DBGET integrated database retrieval system