KEGG   Xanthomonas fragariae: BER92_02785Help
Entry
BER92_02785       CDS       T04667                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
xfr  Xanthomonas fragariae
Pathway
xfr00550  Peptidoglycan biosynthesis
xfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BER92_02785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xfr01002]
    BER92_02785
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xfr01011]
    BER92_02785
Enzymes [BR:xfr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BER92_02785
Peptidases and inhibitors [BR:xfr01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BER92_02785
Peptidoglycan biosynthesis and degradation proteins [BR:xfr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BER92_02785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AOD13843
UniProt: A0A1Y6HFE2
LinkDB All DBs
Position
623888..625090
Genome map
AA seq 400 aa AA seqDB search
MKFRFAAAAVATFAFGLACAQTPAPQPAPAVAAAPAVVPVPPAPAPAVSKSWILMDYATG
RVLAGENIHQQLAPASITKVMTSYVVAAEIKNGKVKRDDQVMMSERAWREGGAGTDGSYS
GFPVNQTARLEDMEKGMSIQSGNDAAIALAEHVAGSEGAFASLMNSYAGKIGMKDSYFVN
AHGLGAEGHHSTAYDLAMLGRAMVRDYPETYAYNKIKEFQVGTIKQNNRNLLLWRDPAVD
GIKTGHTSEAGYCLLSSAKRGDQRLVAVVMGDTSEKQRADDSLALLNWGFRFFETHSLYA
HDKVVTKQKVWKGQQDEVQLGVAQPLLVSLQRGRYNDLKPSMEVAKNLQAPIKQGQQIGT
VKVSLDGNIIAQAPLVALNAVEEGGFFKRLWDAFWMWWES
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaattccgcttcgccgccgctgccgtggccacgttcgccttcggcctggcctgcgcc
cagacacccgcgccgcagccggctcctgccgtggcggctgcgccggccgtcgtgccggtt
ccgcccgcacccgcgccggccgtgtccaagtcctggatcctgatggactacgccactggg
cgagtgctcgccggtgagaacattcatcagcagctcgccccggccagcatcaccaaggtg
atgacgtcctacgtggtcgcggccgagatcaagaacggcaaagtcaagcgcgacgaccaa
gtcatgatgagcgagcgcgcctggcgcgaaggcggcgccggcaccgacggcagctacagc
ggctttccagtcaatcagaccgcacgtctggaagacatggaaaaaggcatgtctatccag
tccggcaacgatgccgcaatcgccttggccgagcatgtggccggcagcgaaggagccttc
gcctcgctgatgaacagctacgccggcaagatcggcatgaaggactcctacttcgtcaac
gcgcacggcctgggcgccgaaggccatcactccaccgcttacgacctggccatgttgggc
cgtgcaatggtgcgcgattacccggagacctacgcctacaacaagatcaaggaattccag
gttggtaccatcaagcagaacaaccgcaacctgctgctgtggcgcgaccctgcggtggat
ggcatcaagaccggccatacctccgaagccggctactgcctgctgagctctgccaagcgc
ggcgatcagcgtctggtggcggtggtcatgggcgacacctccgaaaagcagcgcgctgac
gacagcctggcactgctcaattggggcttccgcttcttcgaaacccatagtctgtatgca
cacgacaaggtcgtgaccaagcaaaaggtgtggaaggggcagcaggacgaagtgcagctc
ggtgtggcgcaaccactgctggtgagcctgcagcgcggccgctacaacgacctcaagccc
agcatggaagtagccaagaacctgcaggccccgatcaagcagggtcagcaaatcggtacg
gtcaaggtcagcctggacggcaatatcatcgcccaggcgccgctagtggcgctcaacgcc
gtcgaagaaggtggattcttcaagcgcctctgggatgccttctggatgtggtgggaatcg
taa

DBGET integrated database retrieval system