KEGG   Xanthomonas fragariae: BER92_03240Help
Entry
BER92_03240       CDS       T04667                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
xfr  Xanthomonas fragariae
Pathway
xfr00620  Pyruvate metabolism
xfr01100  Metabolic pathways
xfr01120  Microbial metabolism in diverse environments
xfr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BER92_03240
Enzymes [BR:xfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     BER92_03240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: AOD13915
UniProt: A0A1Y6HAL1
LinkDB All DBs
Position
725495..727813
Genome map
AA seq 772 aa AA seqDB search
MSNDDFKQAALEYHRQQPAGKLRVTATKPMLTQRDLSLAYSPGVAFACEAIVEEPTQASE
LTARGNLVAVITNGTAVLGLGNIGPLASKPVMEGKGVLFQKFAGIDVFDIEINENDPDKL
VDIIASLEPTFGGINLEDIKAPECFIVERKLRERMNIPVFHDDQHGTAIIVGAAVLNALV
VTGKKIEEVKLATTGMGAAGISCVNMLVSLGLKPENILALDRDGVIHAGRTDLDPDKQRY
ARDTDKRTLAEIVEGADIFLGLSAAGILKPEMVATMARQPVIFALANPNPEITPEVAKAV
RPDCIIGTGRSDYPNQINNVLCFPYLFRGALDVGATGINEEMKIACVKAIAAMARREASD
LGAAYGGETPSFGPDYLIPRPLDPRLLVELSSAVAQAAMDSGVATRPIADMEAYRDKLGQ
FVYRTSLMMKPVYDRARADKQRVVYAEGEEEVVLRAVQNVVDEGLAFPILIGRPDVIEAR
IERMGLRLTAGVDFEITNILDDPRFNEYWQYYHALTERRGVTVTAAKELMRSRPTLIAAV
MVARGEADAMLSGVVGRFHKKLGYARSVIPLEPRVSSTSAMTGVINQLGVFFFLDTHVQE
DPTVEQVVEATLQAAYRLKLFGIEPNIALLSHSNFGSHDSRDALKMRQVREALLKRKPEL
NIDGEMQGDTAWDEALRKQIMPNSTLKGRANLFVLPNLEAANIAYNLVRVFTDGVAIGPI
LMGISKPVHILTTSATSRRVMNMTAIAAVDAQIRKQRDAEKSAAEKSSSGGC
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgacgacttcaaacaggccgccctcgaataccaccgccagcagccggccggc
aagctccgagtcactgcgaccaagccgatgctgacccagcgcgacctgtcgctggcgtat
tcgccgggcgtggccttcgcctgcgaggcgatcgtcgaagaacccacccaggccagcgag
ctcaccgcacgcggcaatctggtggcggtgatcaccaacggcaccgccgtgctgggcttg
ggcaacatcggcccgctggcctccaagccggtgatggaaggcaagggcgtgctgttccag
aagttcgccggcatcgatgtcttcgatatcgagatcaacgagaacgacccggacaagctg
gtcgacatcatcgccagcctggagccgacattcggcggcatcaatctggaagacatcaag
gcgccggaatgcttcatcgtcgagcgcaagctgcgcgagcgcatgaatattccggtgttc
catgacgaccaacacggcaccgcaatcatcgtcggcgcggcggtgctcaacgcgctggtg
gtcaccggcaagaagatcgaagaggtcaagctggccaccaccggcatgggcgcagccgga
atctcctgcgtcaacatgttggtctcgctgggcttgaagccggagaacatcctggcgctg
gaccgcgacggcgtgatccacgccggccgcaccgatctggatcccgacaagcagcgctac
gcacgcgacaccgacaagcgcacgctggccgaaatcgtcgaaggcgcggacatcttcctg
ggtctgtcggcggccggtatcctcaagccggaaatggtcgccaccatggcgcgccagccg
gtgatcttcgcactggccaatcccaacccggagatcaccccggaagtggccaaggcggtg
cgtccggattgcatcatcggcactggtcggtctgactatccgaaccagatcaacaacgtg
ctgtgtttcccgtatctgttccgtggtgcgctggacgtgggcgctaccggcatcaacgaa
gaaatgaagatcgcctgcgtcaaggcgattgccgcgatggcgcgccgcgaggcctccgac
ctgggcgcagcctacggtggcgaaactccgagtttcggcccagactacctgattccgcgg
ccgctggacccgcgtctgttggtggagttgtcctccgccgttgcgcaggccgcgatggat
tcgggcgtggccacgcgcccgatcgccgacatggaggcctaccgcgacaagcttggccag
ttcgtctaccgcaccagcctgatgatgaagccggtctacgaccgcgcgcgcgccgacaag
cagcgcgtggtgtatgccgaaggcgaagaagaagtggtgctgcgcgcggtgcagaacgtg
gtcgacgaaggcttggccttcccgatcctgatcggccgcccggacgtcatcgaagcgcgt
atcgagcgcatgggcctgcgcctgaccgcgggggtggacttcgaaatcaccaacatcctc
gacgacccgcgcttcaacgaatactggcagtactaccacgcgctcaccgagcggcgcggc
gtgaccgtcaccgccgccaaggagctgatgcgctcgcgtccgacactgattgccgcggtg
atggtggcgcgcggcgaagccgatgcgatgctttcgggcgtggtcggccgcttccacaag
aagctgggttacgcacgcagcgtgattccgctggaaccgcgcgtgagttccacctcggcg
atgaccggcgtgatcaaccaattgggcgtgttcttcttcctagatacgcacgtgcaggaa
gacccgaccgtggagcaagtggtggaggcgaccttgcaggccgcctatcgcctcaagttg
ttcggcatcgagcccaatatcgccctgctgtcgcattccaacttcggcagccacgactcg
cgcgacgcgctgaagatgcgccaggtgcgcgaggccctgctcaaacgcaagccagagctc
aacatcgacggcgaaatgcagggcgacactgcctgggacgaagcgctgcgcaagcaaatc
atgccaaatagcaccttgaagggccgcgccaacctgttcgtgctgccgaatctggaagcg
gccaacatcgcctacaacctggtgcgcgtgtttaccgatggcgtagcgatcggcccgatc
ctgatgggaatctccaaaccggtgcacatcctcaccaccagcgccacctcacgccgggtg
atgaacatgaccgccatcgccgcggtagacgcgcagatccgcaagcagcgcgatgccgag
aagagcgcggctgaaaagagcagcagcggaggttgctag

DBGET integrated database retrieval system