KEGG   Xanthomonas fragariae: BER92_04880Help
Entry
BER92_04880       CDS       T04667                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xfr  Xanthomonas fragariae
Brite
KEGG Orthology (KO) [BR:xfr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BER92_04880
Enzymes [BR:xfr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BER92_04880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like DAO Glutaredoxin FAD_binding_3 NAD_binding_7 AlaDh_PNT_C FMO-like K_oxygenase Thioredoxin_4 NAD_binding_8 Spermine_synth Thi4
Motif
Other DBs
NCBI-ProteinID: AOD14186
UniProt: A0A1Y6H9M0
LinkDB All DBs
Position
complement(1095039..1096631)
Genome map
AA seq 530 aa AA seqDB search
MLDATLKTQLTAYLERVTRPIQIDASIDDTPQAREMLDLLEDLLLLSDKISLDIHRDDNQ
RKPSFALTTPGQDISLRFAGLPMGHEFTSLVLALLQVGGHPSKATAELIEQVQQLDGDYQ
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGALFQDEVETRQIMSVPTVYLNGKL
FDQGRMTLEQIVAKLDTNAAKREAARIAAKDAFEVLVVGGGPAGSAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGADG
LIEIKLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGVVAHVTLVEFDDKLRADEVLQRKLRSLHNVRIITSAQTTEVLGDG
QKVTGLVYKDRTGGDIQHVELEGVFVQIGLLPNTEFLKGSVALSPRGEIIVDDRGQTNVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRSSAPISADKVAKAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccacgctcaagacccagctgactgcctacctggaacgggtcacgcgaccg
atccagatcgatgcctcgatcgacgacacgccccaggcccgcgaaatgctcgacctgctt
gaggatctgctgttgctgtcggacaagatcagcctggatatccaccgtgacgacaaccag
cgcaaaccttcgttcgcactgaccacgccgggccaggatatctcgctgcgctttgccggc
ctgccgatgggccatgagttcacctcgctggtgctggcactgctacaggtcggcggtcac
ccgtccaaggccactgccgagctgatcgagcaggtgcagcagctggatggcgactaccag
ttcgagacctatttctcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaat
cttgccgccgtgctcaacccgcgcatcaagcacgtcgccatagacggtgcgctgttccag
gacgaagtcgaaacccgccagatcatgtcggtgccgaccgtgtacttgaacggcaagctg
ttcgaccagggccgcatgacgctggagcagatcgtcgccaagctcgacaccaacgccgca
aagcgagaggccgccaggatcgcggccaaggacgcgttcgaggtgctggtcgtcggcggt
ggtccggccggttcggcagcggcggtgtatgccgcgcgcaagggcatccgcaccggcgtg
gccgccgagcgtttcggtggtcaggtgctggacaccatgtcgatcgagaacttcatctcg
gtgccggaaaccgaaggcccgaagatggccgccgcattggaacagcacgtgcgccagtac
gacgtggacatcatgaatctacagcgcgccgagcagctgatcccggccggtgccgatggc
ctgatcgaaatcaagctggccaatggcgcatcgctcaagagcaagaccgtgatcctgtcc
accggcgcacgctggaggcagatgaatgtgccgggcgaagaccagtacaagaacaagggc
gtggcctattgcccgcattgtgacggcccgctgttcaagggcaagcgcgttgcggtgatc
ggcggcggcaactcgggcgtggaagcggcgatcgatctggccggtgtcgtggcgcatgtc
acgctggtggaattcgacgacaagctgcgcgccgatgaagtattgcaacgcaagctgcgc
agcctgcacaacgtgcgcatcatcaccagcgcacagactacagaagtgcttggcgatggc
cagaaagtgaccggcctggtctacaaggaccgcaccggtggcgatatccagcatgtcgag
ttggaaggcgtgttcgtgcagatcggcttgctgcccaacaccgaattcctcaagggatcg
gtggcgttgtcgccacgcggtgagatcatcgtcgacgaccgtggccagaccaacgtaccc
ggcgtgttcgccgcgggcgacgccaccacggtgccgtacaagcagatcgtgatcgcgatg
ggcgaaggttccaaagcggcactgagcgcgttcgattacttgatccgctccagcgccccg
atcagcgccgacaaggtggccaaagctgcgtaa

DBGET integrated database retrieval system