KEGG   Xanthomonas fragariae: BER92_08395Help
Entry
BER92_08395       CDS       T04667                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
xfr  Xanthomonas fragariae
Pathway
xfr00380  Tryptophan metabolism
xfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BER92_08395
Enzymes [BR:xfr01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BER92_08395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AOD14753
UniProt: A0A1Y6H9S2
LinkDB All DBs
Position
complement(1850150..1851421)
Genome map
AA seq 423 aa AA seqDB search
MIDPLSRSHAAALDVADPLRSLRDDFVFPQHGDQEQTYLVGHSLGLQPRATRAMVAEVLD
QWGALGVEGHFTGPTQWLTYHQLVRDCLARVVGALPGEVVAMNALSVNLHLMMVSFYRPT
PQRGAILIEAGAFPSDRHAVESQLRLHGLDPATHLIEVDADEPNGTLSMAAITDAIAQHG
PRLALVLWPGVQYRTGQAFDLGEIVRLARAQGAAVGLDLAHAVGNLPLTLHDDGVDFAVW
CHYKYLNAGPGAVGGCFVHQRHAHSDLPRMAGWWGHAQQTRFRMDPQFVPSPGAEGWQLS
NPPVLALAPLRASLELFDHAGMAALRTKSEQLTGYLEQLIHARVPQVLQIVTPAEPSQRG
CQLSLRVAGGGAQGRSLFEYLHSVGVLGDWREPDVIRIAPVPLYNRFCDLHQFVEHVETW
AAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccctctgtcccgctcccatgccgctgcgctggatgtcgccgacccgctgcgc
agcctgcgcgatgacttcgtgttcccgcagcatggcgaccaggagcagacctatctcgtc
ggccattcgctcggcctgcaaccgcgcgccacgcgcgcgatggtcgccgaggtgctcgac
caatggggcgcacttggggtggaaggtcactttaccggacccacacaatggctgacctat
caccaactggtgcgcgactgcttggcacgcgtggtcggcgcactgccaggcgaagtggtg
gcaatgaacgcgctaagcgtcaatctgcacctgatgatggtcagcttttatcgccccacg
ccgcagcgcggcgcgatcttgatcgaagcgggcgcgtttccgtccgaccgacatgcggtg
gaatcgcaactgcgactgcacgggctggatccggccacgcacctgatcgaagtggacgcc
gatgaaccgaatggcacgttatcgatggcggcgattaccgatgccatcgcacagcacggc
ccgcgtcttgcgttggtgctgtggccaggcgtccagtaccgcactggccaagccttcgat
ctgggcgaaatcgtgcggctggcgcgtgcacagggcgctgcggtgggcttggacctggcg
catgcggtcggcaatcttcccctgacgctgcacgacgatggcgtcgatttcgcggtgtgg
tgccactacaaatatctcaacgccggtccaggtgcggtgggcggctgctttgttcaccaa
cgccacgcccacagcgatttaccgcgcatggctggctggtgggggcacgcgcagcaaacg
cgcttccgcatggacccgcagttcgtgccctcgcctggcgccgaaggctggcagctgagc
aatccgccggtgctggcactggctccgttgcgtgcgtcgttggagctgttcgatcacgcc
ggtatggccgcgctacgcaccaagtccgaacaactcaccggctacttggaacagctgatc
catgcacgcgtgccgcaggtgctacagatcgtgacgccggccgagccttcgcagcgcggc
tgtcaattgtcgttgcgggtggccggtggaggcgcgcagggacgctcgctgttcgagtac
ctgcactcggtcggcgtactcggcgattggcgcgaaccggacgtgatacgcatcgctccg
gtgccgctgtacaaccgcttctgcgatctgcaccagttcgtggagcacgtggaaacctgg
gccgccgcctga

DBGET integrated database retrieval system