KEGG   Xanthomonas fragariae: BER92_11705Help
Entry
BER92_11705       CDS       T04667                                 

Definition
(GenBank) 7,8-dihydro-8-oxoguanine-triphosphatase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
xfr  Xanthomonas fragariae
Brite
KEGG Orthology (KO) [BR:xfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xfr03400]
    BER92_11705
Enzymes [BR:xfr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BER92_11705
DNA repair and recombination proteins [BR:xfr03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BER92_11705
 Prokaryotic Type
    BER92_11705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: AOD15275
UniProt: A0A1Y6HD05
LinkDB All DBs
Position
complement(2582536..2583024)
Genome map
AA seq 162 aa AA seqDB search
MPYTPIVATLGYLLSPDGTQVLMIHRTARPGDQHLGKYNGLGGKVEPDEDVLAGMRREIR
EEAGVECGEMQLRGTISWPGFGKHGEDWLGFVFLIGSFEGTPQTSNPEGTLEWVAIDQMD
QVPMWEGDRNFLPLVFDGDPRPFHGVMPYRDGRMQSWTYSRI
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgccctatacccccattgtcgccacgcttggctacctgttatcgccggacggcacgcag
gtgttgatgatccatcgcactgcccgtcccggcgatcaacacctgggcaagtacaacggg
ctcggcggcaaggtggaaccggacgaagacgtgctagccggcatgcgccgcgagattcgc
gaagaagccggcgtcgagtgcggtgaaatgcaattgcgcgggaccatcagctggccgggc
ttcggcaagcacggcgaggactggctgggctttgtgttcctgatcggcagcttcgaaggc
acgccgcagacctcgaacccggagggcacactggaatgggtggccatcgaccagatggac
caggtgcccatgtgggaaggcgaccggaacttcctgccgttggtgttcgacggcgacccg
cgtccgttccatggcgtcatgccatatcgcgatgggcgcatgcagtcgtggacatattcg
cggatctaa

DBGET integrated database retrieval system