KEGG   Xanthomonas fragariae: BER92_18620Help
Entry
BER92_18620       CDS       T04667                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xfr  Xanthomonas fragariae
Brite
Enzymes [BR:xfr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BER92_18620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AOD16315
UniProt: A0A1Y6HRA5
LinkDB All DBs
Position
4058926..4059585
Genome map
AA seq 219 aa AA seqDB search
MRILPTTLFLATALVLTSCKREEPAPADPAPAPAPAPQASTPAEAAHVGEHAASMVTEAA
ATTTATAELQPTKGNEVKGTVRFKTVDGALRVTGQLSGLKPNTEHGFHIHEKGDCSAPDG
SSAGGHLNPAQSDHGNVTADPHHGGDMPNIKADAQGNARIDGPVSSNVNLGKADQFDIAG
HAVIVHADADDYKTQPTGNAGGRLACGVITTDNAQAATK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattctcccgacgaccttattcctggccaccgcgctggtgctgacctcgtgcaag
cgcgaggagcccgcaccggccgaccctgcacctgcacctgcacctgcaccgcaggccagc
acgccggccgaagcggcgcatgttggcgagcatgccgcctccatggtcaccgaggcggcg
gccaccaccaccgcaaccgccgagctccagccgaccaagggcaatgaggtcaagggcacg
gtgagattcaagaccgtcgacggcgcactgcgcgtgaccggtcagctgagcggcctcaag
cccaacaccgaacacggcttccatatccacgaaaagggcgattgcagcgcaccggacggc
agcagcgccggagggcacctcaatccggcccaatccgatcacggtaatgtcaccgccgac
ccgcaccacggcggcgatatgccgaacatcaaagccgatgcgcagggcaatgcccgcatc
gatggcccggtgtcgagcaacgtcaatctgggcaaggcagaccagttcgatatcgccggc
cacgcagtaatcgtgcacgccgatgcggacgactacaaaacccagcccaccggcaacgcc
ggcggccgtctggcgtgcggtgtgatcaccaccgacaacgcgcaggctgcaacaaagtag

DBGET integrated database retrieval system