KEGG   Xylella fastidiosa subsp. sandyi Ann-1: D934_10880Help
Entry
D934_10880        CDS       T03318                                 

Definition
(GenBank) prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
xfs  Xylella fastidiosa subsp. sandyi Ann-1
Pathway
xfs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xfs01100  Metabolic pathways
xfs01110  Biosynthesis of secondary metabolites
xfs01130  Biosynthesis of antibiotics
xfs01230  Biosynthesis of amino acids
Module
xfs_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
xfs_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:xfs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D934_10880
Enzymes [BR:xfs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     D934_10880
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     D934_10880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT
Motif
Other DBs
NCBI-ProteinID: AIC10487
UniProt: A0A060HC38
LinkDB All DBs
Position
complement(2166347..2167471)
Genome map
AA seq 374 aa AA seqDB search
MTKPVNTTADKVALSDTALANIRTKIDKIDRDIQTLIAERACYAQQVGQAKSKLAAAMDY
YRPEREAQVLRMVVERNEGPLSDEVLVRLFREIMSACLAQQEPLKIGYLGPEGTFSQQAV
LKHFGHYVLGEPMASIEEVFQEVEAGHTDFGVVPVENSGHGTIQVTLDLFLNSKLKICGE
IELRVHQYLMSRSGRLEDIHRIYAHPQSFAQTACWLRANLPHVEKIPVSSNAEGARRASN
ANDAASIGSESAARVYALSKVFIHSIEDEQDNTTRFLVIGRRIFAPSGCDRTSILVFIRD
NPGALFEVLGSFARHGINMNRIESRPSHQVRWEYVFFIDLLGHVEDEPMKQALAELEQHA
VKVKILGAYPIALL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgactaagccggttaatactactgctgacaaggttgctctgtctgacacggcattggcc
aatatccgcactaaaatcgataagattgaccgtgatattcagacattaattgccgaacgt
gcgtgttatgcccagcaagtcggtcaggcaaaaagcaaacttgccgctgcgatggattac
taccgccccgagcgtgaagcgcaggtgctacgtatggtggtggaacgcaatgaaggtccg
ttgtcagatgaagtgctagtccgcttattccgtgaaattatgtctgcctgtttagcccag
caggaaccattgaagattggttaccttggtccggaaggcacctttagccaacaagcagtg
ctcaaacactttggccattatgtccttggcgagcctatggccagtattgaggaggtgttc
caggaggtcgaggccggtcataccgatttcggagtagtgccggtggagaattcaggtcat
ggaacaatccaggttacgctggatttgtttttgaattctaaattgaaaatctgtggcgag
attgagttgcgcgtgcatcaatatctgatgtctcgtagtggtcgccttgaagacattcat
cggatctatgcgcacccgcagtcgtttgcgcagaccgcctgttggctacgtgccaatctg
cctcatgttgagaaaatccctgtgtctagcaacgccgaaggtgcacgtcgtgcctccaat
gctaacgatgcagcttcgatcggtagcgagagcgccgcgcgagtgtatgcgttgagcaag
gtgttcatacactcaattgaagatgagcaggacaatacaacgcgttttctggtgatcggt
cgtcggatatttgcgccttccggatgcgatcgtacttcgattcttgtgtttattcgtgac
aaccctggcgcattgtttgaagtgcttggttcatttgcgcgtcacggtatcaacatgaat
cgtattgaatcgcgcccttcccatcaggtcagatgggagtatgtcttttttattgatttg
cttggccatgttgaggatgaaccgatgaaacaggcactggctgaattggagcaacatgcg
gtgaaggtcaagatcctcggagcctatccaattgcccttctatga

DBGET integrated database retrieval system