KEGG   Xylella fastidiosa subsp. sandyi Ann-1: D934_13165Help
Entry
D934_13165        CDS       T03318                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
xfs  Xylella fastidiosa subsp. sandyi Ann-1
Pathway
xfs00473  D-Alanine metabolism
xfs00550  Peptidoglycan biosynthesis
xfs01100  Metabolic pathways
xfs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xfs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D934_13165
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D934_13165
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    D934_13165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xfs01011]
    D934_13165
Enzymes [BR:xfs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     D934_13165
Peptidoglycan biosynthesis and degradation proteins [BR:xfs01011]
 Precursor biosynthesis
  Amino acid ligase
   D934_13165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AIC10803
UniProt: A0A060H5E9
LinkDB All DBs
Position
complement(2631954..2632916)
Genome map
AA seq 320 aa AA seqDB search
MGMSIFSLSPRYTDPAVFGRVAVLLGGTSAEREVSLLSGRNVLEVLRRRGVDAQSVDGVP
ALAQALVERRFDRVFNVLHGHNGGGEDGVVQGLMQAFGVPYTGSDVLGSALSMDKVRTKQ
VWLALGLPTPRYASLSVCATAVEVRKAVEMLGFPVIIKPAKEGSSVGVSRVFALEHLEEA
VALAARYEGELLMEQLIEGDELTVSILDEMALPSIRIVPQGQWYDYNAKYLAEDTQYVCP
GLDDVAEAEIAQLALAAFHSVGCRGWGRVDVMREHGSGRFFLLEVNTAPGMTTHSLVPKA
ASQLGMGFDDLVWRILEQTL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgggtatgagcatattttcactgtctccacggtatacggatccggcggtgtttggtcgt
gttgcagtgttattaggggggacgtctgctgagcgtgaggtgtctttgctttcaggtcgt
aatgtgttggaagtattgcgcaggcgcggtgttgatgctcagtcggtagatggggttccg
gcactcgctcaggcgctggtggaacggcgttttgatcgtgtgtttaatgtgttgcacggc
cataatggcggtggtgaggatggtgtggtgcaggggttgatgcaggcttttggtgtgccg
tatacaggttcggatgtgcttggttcagcgttgagtatggataaggtgcgcactaaacag
gtttggcttgcgctgggtttgccgacgccgcgttatgcgagtttgagtgtgtgtgccact
gctgttgaggtgcgtaaggcggttgagatgctaggttttccggtgattattaagccggct
aaagaagggtctagtgttggtgtcagtcgtgtgtttgcactggagcatttggaggaggcg
gttgctttagcggcgcgttacgagggtgagttgctgatggagcagttgatcgaaggggat
gaattgacggtgtcgattcttgatgagatggcgttgccctcaattcggatcgttcctcag
gggcagtggtatgactataacgcgaagtatcttgctgaagacacgcagtatgtgtgcccg
ggtttggatgatgttgctgaggctgaaatcgctcaacttgcgttggctgcattccatagt
gttggttgtcgtggttggggtcgtgtggatgtgatgcgcgagcacggcagtgggcgcttt
ttcttattggaagtcaatactgctcctggaatgacgactcactcgttagtgccaaaggca
gcgagtcagttgggtatgggttttgatgatttggtgtggcggattctggagcagacttta
tga

DBGET integrated database retrieval system