KEGG   Xylella fastidiosa Temecula1: PD_1864Help
Entry
PD_1864           CDS       T00113                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
xft  Xylella fastidiosa Temecula1
Pathway
xft00473  D-Alanine metabolism
xft00550  Peptidoglycan biosynthesis
xft01100  Metabolic pathways
xft01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xft00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PD_1864 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PD_1864 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PD_1864 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xft01011]
    PD_1864 (ddlB)
Enzymes [BR:xft01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PD_1864 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:xft01011]
 Precursor biosynthesis
  Amino acid ligase
   PD_1864 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AAO29696
UniProt: Q87AG1
LinkDB All DBs
Position
complement(2190697..2191611)
Genome map
AA seq 304 aa AA seqDB search
MFGRVAVLLGGTSAEREVSLLSGRNVLEVLRMRGVDAQSVDGVPALAQALVERRFDRVFN
VLHGHNGGGEDGVVQGLMQAFGVPYTGSDVLGSALSMDKVRTKQVWLALGLPTPRYASLS
VCATAVEVRKAVEMLGFPVIIKPAKEGSSVGVSRVFALEHLEEAVALAARYEGELLMEQL
IEGDELTVSILDEMALPSIRIVPQGQWYDYNAKYLAEDTQYVCPGLDDVAEAEIAQLALA
AFHSVGCRGWGRVDVMRERGSGRFFLLEVNTAPGMTTHSLVPKAASQLGMGFDDLVWRIL
EQTL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgtttggtcgtgttgcagtgttattaggggggacgtctgctgagcgtgaggtgtctttg
ctttcaggtcgtaatgtgttggaagtattgcgcatgcgcggtgttgatgctcagtcggta
gatggggttccggcactcgctcaggcgctggtggaacggcgttttgatcgtgtgttcaat
gtgttgcacggtcataatggcggtggtgaggatggtgtggtgcaggggttgatgcaggct
tttggtgtgccgtatacaggttcggatgtgcttggttcagcgttgagtatggataaggtg
cgcactaaacaggtttggcttgcgctgggtttgccgacgccgcgttatgcgagtttgagt
gtgtgtgccactgctgttgaggtgcgtaaggcggttgagatgctaggttttccggtgatt
attaagccggctaaagaagggtctagtgttggtgtcagtcgtgtgtttgcactggagcat
ttggaggaggcggttgctttagcggcgcgttacgagggtgagttgctgatggagcagttg
atcgaaggggatgaattgacggtgtcgattcttgatgaaatggcgttgccctcaattcgg
atcgttcctcaggggcagtggtatgactataacgcgaagtatcttgctgaagacacgcag
tatgtgtgcccgggtttggatgatgttgctgaggctgaaatcgctcaacttgcgttggct
gcattccatagtgttggttgtcgtggttggggtcgtgtggatgtgatgcgcgagcgcggc
agtgggcgctttttcttattggaagtcaatactgctcctggaatgacgactcactcgtta
gtgccaaaggcagcgagtcagttgggtatgggttttgatgatttggtgtggcggattctg
gagcagactttatga

DBGET integrated database retrieval system