KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr01250Help
Entry
XFF4834R_chr01250 CDS       T03094                                 

Gene name
aldB
Definition
(GenBank) probable Aldehyde dehydrogenase B
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00010  Glycolysis / Gluconeogenesis
xfu00620  Pyruvate metabolism
xfu01100  Metabolic pathways
xfu01110  Biosynthesis of secondary metabolites
xfu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XFF4834R_chr01250 (aldB)
   00620 Pyruvate metabolism
    XFF4834R_chr01250 (aldB)
Enzymes [BR:xfu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     XFF4834R_chr01250 (aldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: CDF59806
LinkDB All DBs
Position
complement(154590..156122)
Genome map
AA seq 510 aa AA seqDB search
MMNAQPATKPLNTDPQSIFKPRYDNFIGGTWVAPKGGQYFDNTTPINGKVLTSIARSTAP
DIEAALDAAHAAKNAWGKTSTTERSNILLKIADRIEQNLELLAYAETWDNGKPVRETLNA
DVPLCVDHFRYFAGAIRAQEGGISEIDSDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLA
PALAAGNCVVMKPAEQTPASILVLMELIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKI
AFTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVLFAFN
QGEVCTCPSRALIQESIYDAFMEKALARVAAIKQGNPLDPNTMVGAQASSEQLEKILSYI
DIGKQEGAEVLIGGERNTLDGDLAEGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKDE
ADALAIANDTLYGLGAGVWSRDASRLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGI
GRENHKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgcgcaacctgccaccaagccgctcaacaccgatccgcagtcgatcttcaaa
ccgcgctacgacaacttcatcggcggtacgtgggtcgcgccgaagggggggcaatatttc
gacaacaccacgccgatcaacggcaaggtccttacctcgatcgcccgctccactgcaccg
gatatcgaggcggcgctggatgccgcgcacgcggccaagaatgcatggggcaagacctcc
accaccgagcgttccaacatattgctcaagatcgccgaccgcatcgaacagaatctcgaa
ctgctcgcgtacgccgagacctgggacaacggcaagccggtgcgcgaaacgctcaatgcc
gacgtgccgttatgcgtggaccacttccgctatttcgctggcgccatccgcgcgcaggaa
ggcggcatttccgagatcgacagcgacaccattgcctatcatttccatgagcccttgggc
gtggtggggcagatcatcccgtggaatttcccgctgctgatggcgtgctggaaactcgca
ccggctctggctgccggtaactgcgtggtgatgaaaccggcagagcagacgcccgcctcg
atcctggtgttgatggaactcatcggcgacctgctaccgcccggcgtgttgaacgtggtc
aacggcttcggcctggaggccggcaagccgctggccagcaacccgcgcatcgccaagatt
gcgttcaccggcgaaaccaccaccggccggctgatcatgcagtacgccagtcagaacctg
attccggtgacgctggagctgggtggcaagtcgcccaacattttctttgccgatgtcatg
gccgaagacgacgattttctcgacaaggcggtggaaggcttcgtgctgttcgccttcaac
cagggcgaggtgtgtacctgcccgtcgcgcgcgctgatccaggaatccatctacgacgct
ttcatggagaaggcgctcgcgcgcgtggccgcgatcaagcagggcaatccgctcgatccc
aacaccatggtcggtgcgcaggcgtccagcgaacagttggaaaaaatcctctcctacatc
gacatcggcaagcaggaaggtgccgaagtgttgatcggcggcgagcgcaatacgctcgat
ggcgatctggccgagggtttttacgtcaagcccacggtgttcaaaggccacaacaagatg
cgcgtgttccaggaggagatcttcggcccggtggtctcggtcaccaccttcaaggacgag
gccgacgcgctggcgatcgccaacgacacgctgtacggcctgggtgccggtgtctggagt
cgcgacgcttcgcgcctgtatcggatgggccgtgcgatccaggctggccgcgtgtggacc
aattgctatcacgcctatcctgcgcatgctgcattcgggggctacaagcagtcgggtatc
ggccgcgagaatcacaagatgatgctcgaccactatcagcagaccaagaacctgttggtg
agctattcgccgaaggcgctggggtttttctaa

DBGET integrated database retrieval system