KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr01780Help
Entry
XFF4834R_chr01780 CDS       T03094                                 

Definition
(GenBank) hypothetical superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xfu  Xanthomonas citri pv. fuscans
Brite
Enzymes [BR:xfu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XFF4834R_chr01780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-ProteinID: CDF59856
UniProt: A0A2H1SCK7
LinkDB All DBs
Position
216789..217436
Genome map
AA seq 215 aa AA seqDB search
MRIVPTTLFLATALVLTACKRDEPAPAEPAPAPQASTPAEAAHGGEHAASMVTEAAATTT
ATAELKPTKGNDVKGTVTFKTVDGALRVTGQLSGLKPNTEHGFHIHEKGDCSAPDGSSAG
GHFNPSQSDHGNVSADPHHGGDMPNIKSDAQGNASIDGPVSSNVNLGKADQFDIAGHAVI
VHADADDYKTQPTGNAGGRLACGVITTDNAQAPTK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgttccgaccaccctgtttctggccaccgccctggtgctgaccgcgtgcaag
cgcgacgaaccggcgccggccgagccggcacctgcgccgcaggccagcacgccggccgaa
gcggcgcacggtggcgaacacgccgcttccatggtcaccgaagcggcagccaccaccacc
gcaaccgccgagctcaagccgaccaagggcaatgacgtcaaaggcacggtgacgttcaag
accgtggacggtgcgctgcgtgtcaccggccagctcagcggcctcaagcccaataccgag
cacggcttccacatccacgaaaagggcgattgcagcgcaccggacggcagcagcgccggc
ggtcacttcaacccgtcccagtccgatcacggcaatgtcagcgccgacccgcaccacggc
ggcgacatgcccaacatcaaatccgatgcgcagggtaacgccagcatcgacggcccggtc
tccagcaatgtcaatctcggcaaggccgaccagttcgatatcgccggccacgcggtgatc
gtgcatgccgatgccgacgactacaaaacccagcccaccggcaacgcgggtggccgcctg
gcctgcggcgtgatcaccacagacaacgcgcaggcgccgaccaagtaa

DBGET integrated database retrieval system