KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr06680Help
Entry
XFF4834R_chr06680 CDS       T03094                                 

Gene name
mrdA
Definition
(GenBank) Probable penicillin-binding protein 2 (transpeptidase involved in peptidoglycan synthesis)
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00550  Peptidoglycan biosynthesis
xfu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XFF4834R_chr06680 (mrdA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    XFF4834R_chr06680 (mrdA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xfu01011]
    XFF4834R_chr06680 (mrdA)
Enzymes [BR:xfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     XFF4834R_chr06680 (mrdA)
Peptidoglycan biosynthesis and degradation proteins [BR:xfu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   XFF4834R_chr06680 (mrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CDF60304
UniProt: A0A2H1SAK8
LinkDB All DBs
Position
763761..765821
Genome map
AA seq 686 aa AA seqDB search
MHGRRHPKNPHAEAEQFRRRAVLGFVMVVICLVGLGGWYFKLQVLDHEVYATRSEANRIK
PKPVVPGRGMIYDRTGRLLAENVPAFRLDVTPDKVTDMNAMLDALGKVIPIAPEDLERFN
RERRARRSFLPVTLKLRMSDEEMARFAVERWRFPGVELEPYLTRRYPYGPLFAHIIGYVG
RIDEKDLAVLGEGNAALTHMGKSGLERYYEQDLRGQVGYEQVETNVQGRAIRTVGRVAPQ
SGADLRLSVDADLQRAMVAAFGEHEGAAIAMDPRTGEILGMVSLPSYDPNLFVNGISHTD
FKMLNDNPSRPQFNRLVLGGVAPGSTLKPLIALAGLDSGLRRPEDRVLSTGMFYLPGVSR
GWGDSHRGGHGWTDLRKSIAQSVNTYYYRLAVDMGIERFDRYLGDYGFGQPTGVDLLGEI
GGILPSPAYKYKTRKERWYPGDTVNIAIGQGDWKVTPLQLVRGISATASGLLLRPHLVLE
ERTGFDHPWQPMIQPPGKPISTNAAHLQAVREGMMDTMRPGGTGYAITPGAPYQMAGKTG
TAQVVSRKGVAAVDPRSLPMHLRHRGLFVGFAPADNPVIAVAVAVEGGGFGTSSAAPIAR
KIFDAWLLGKMPAGLEPLDSELGMTAVGVNQFEAGVTDARAAGDAAAATLDELPVVIGQT
AVALDPNTPAQPVVPDVPDAVQETDH
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgcacgggcgccgtcatccgaagaatccgcatgcggaggccgaacagttccgccgccgc
gcggtgctgggctttgtgatggtggtgatctgcctggtcggcctgggcggctggtatttc
aagctgcaggtgctcgaccacgaggtctacgccacccgctcggaggccaaccgcatcaag
cccaaaccggtggtgcccgggcgcggcatgatctacgaccgcaccggccggctgctggcc
gaaaacgtgccggccttccgtctggacgtgacccccgacaaggtcaccgacatgaacgcc
atgctggacgcgttgggcaaggtgatcccgatcgcgccggaggatctggagcgcttcaac
cgcgagcgccgcgcgcgccgcagcttcctgccggtgacgctcaagctgcgcatgagcgat
gaagagatggcgcgctttgcggtggagcgctggcgtttccctggtgtggaactggagccg
tatctgacccggcgctacccgtacggcccgttgttcgcgcacatcatcggctacgtcggc
cggatcgacgaaaaagacctggcggtgctgggcgagggcaatgccgcgctcacccacatg
ggcaaatccggattggagcgctactacgaacaggatctgcgcgggcaggtcggttacgag
caggtcgaaaccaatgtgcaggggcgggccatccgcaccgtcggccgggtcgcgccgcaa
tcgggtgcggacctgcgcctgtcggtggatgccgacctgcagcgcgcgatggtggccgcg
ttcggcgagcatgaaggcgcggccattgcgatggacccgcgcaccggcgagatcctgggc
atggtcagcctgcccagctacgaccccaatctgttcgtcaacggcatctcgcataccgat
ttcaagatgctcaacgacaacccgtcgcggccgcagttcaaccggctggtgctcggtggc
gtggcgccgggctccacgctcaagccgctgattgcgctggccggtctggacagcggcctg
cgccggccggaagaccgggtgttgtccaccggcatgttctatctgccgggcgtcagccgc
ggctggggcgactcgcaccgcggcgggcatggctggaccgatctacgcaaatccatcgcc
cagtcggtcaatacctattactaccgcctggcggtggacatgggcatcgagcgcttcgac
cgctatctgggcgactacggtttcggccagcccaccggggtggatctgttgggcgaaatc
ggcggcatcctgccgtcgccggcttacaagtacaagacccgcaaggagcgctggtacccc
ggcgacaccgtcaacatcgcgatcggccagggcgactggaaggtgaccccgctgcagctg
gtgcgcggcatttcggcgactgccagtggcctgctgctgcgtccgcacctggtgctggaa
gagcgcaccggtttcgatcacccctggcagccgatgatccagccgccgggcaagccgatc
agcaccaatgccgcgcatctgcaggcagtgcgcgaaggcatgatggacaccatgcgcccc
ggcggtaccggctacgccatcacccctggcgcgccgtaccagatggccggcaagaccggt
accgcgcaggtggtcagccgcaagggcgtggcggcggtggacccgcgcagtttgccgatg
catctgcgtcaccgcggcctgttcgtcggcttcgcgccggccgacaacccggtcatcgcc
gtggcggtggcggtggagggcggcggcttcggtaccagctcggcggcgccgatcgcgcgc
aagatcttcgatgcctggttgctcggcaagatgcccgccggcctggagccgctggacagc
gagctcggcatgaccgcggtgggcgtcaatcagttcgaagccggtgtgaccgacgcgcgt
gcggccggcgatgcggccgccgccacgctggacgagctgccggtggtgatcggccagacc
gccgttgcgctggaccccaacacgcccgcgcaaccggtggtgccggatgtgccggacgcg
gtgcaggagaccgaccattga

DBGET integrated database retrieval system