KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr08120Help
Entry
XFF4834R_chr08120 CDS       T03094                                 

Gene name
ppc
Definition
(GenBank) probable phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00620  Pyruvate metabolism
xfu00680  Methane metabolism
xfu01100  Metabolic pathways
xfu01120  Microbial metabolism in diverse environments
xfu01200  Carbon metabolism
Module
xfu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XFF4834R_chr08120 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    XFF4834R_chr08120 (ppc)
Enzymes [BR:xfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     XFF4834R_chr08120 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CDF60447
UniProt: A0A2H1SCT9
LinkDB All DBs
Position
940450..943164
Genome map
AA seq 904 aa AA seqDB search
MNEYRSSLVFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAISRRESDAP
PSTLSEQLAGREPRDAEALVRAFSTYFQVVNIAERVHRIRRRREYQRSGTDTPQPDGLHD
ALRRLKAQGVTLDELSQWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRT
PNERASDAARFRMALTASWQTADSSPVRPTVDDEREHVGFYLTQVLYRVVPVMYETLEHA
IEETYGSVPALPRLLRFGTWVGGDMDGNPNVDATTIAGTLDAQRRAVLDRYQKELWQLAS
LLSQSTTLVQVSGELTAQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDNA
DGAYAAPSELEHDLQLILDSLQANKGLHAGWFAVRRLLWRVRSFGFHLARLDVRQESSVH
ARAVADALDQTDWDAQDAAQRAAVLGPYAAGQDPLPRVEDEGNARLDAVFAALADARTRH
GADALGSYIISMAHNRADVLTVLALARRGGLVDDAGAVPLDIVPLFETVDDLRGGTGTVQ
DLLADPVYRQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAAELGVRLT
FFHGCGGSIARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTG
AVLLSSLRPRAPEPREARWRPVMDLVAERSTVAYRAFVGAPEFMQYFRLATPIDVIERMT
LGSRPSRRLGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEDTLREMA
QDWPFFRTFLDDIAMVLSKGDLNIAELFSRLSGDLHTRFFPLIGDELALTKGWVKALLQQ
RSLLQHDPRLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDQALLRALVACVNGVSQGV
QNTG
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagtcttgtgttcgctacccccgatcttcccttgcgcgacgat
gtgcgtcggctcggtgcactggtgggtgatctactcgccgagcaggtctctgcggaattc
ctcgatgaaatcgaacgcgtgcgcaccaccgccatttcgcggcgtgaaagcgatgccccg
ccgtccacgttgagcgagcaattggccggacgcgagccgcgcgacgccgaagcgctggtc
cgggcattcagtacgtatttccaggtggtcaatatcgccgagcgcgtgcaccgcatccgc
cgccgtcgcgaataccagcgtagcggcaccgacacgccgcagcccgatggcctgcacgac
gcattgcgccggctcaaggcgcagggcgtgaccctggacgaactcagccaatggttgccg
cgcatcgacgtggagccggtgttcaccgcgcatcccaccgaggcggtacggcgcgcgctg
ctggagaaagagcagctgatggtcgccagcctggtcgacaacctggacggcatgcgcacg
cccaacgaacgcgccagcgatgccgcgcgctttcgcatggccctgaccgcgtcgtggcag
accgccgattcctcgccggtgcgcccgaccgtggacgacgagcgcgagcatgtgggcttc
tacctcacccaggtgctctaccgcgtcgtcccggtgatgtacgaaacgctcgaacacgcc
atcgaagaaacctacggtagcgtgccggcattgccgcgcctgctgcgcttcggcacctgg
gtgggcggcgacatggacggcaatcccaacgtggatgccaccaccatcgccgggacgctg
gacgcgcagcggcgcgcggtgctggaccgctatcaaaaagaactctggcagttggccagc
ctgctcagccaatcgaccacgctggtgcaggtgagcggcgaactcaccgcgcagctggaa
cgctaccgcgcgttgctccccgacgccgccgcgcgttcgcgcccgcgccatggcgacatg
ccgtaccgcctgctcaacgacctgatgcgcgcgcgcctgcaggccaccctggacaatgcc
gatggtgcctatgccgctccatcggagctcgaacacgatctgcagctgatcctggacagc
ctgcaggccaacaagggcctgcatgccgggtggttcgcggtacgacgcctgttgtggcgc
gtgcgcagctttggtttccatctggcgcggctggacgtgcgccaggaatcgagcgtgcat
gcgcgcgcagtggccgatgccctggaccagaccgactgggacgcacaggacgccgcccag
cgcgccgccgtgctcggcccgtatgccgcagggcaagaccccttgccgcgcgtggaagat
gaaggcaatgcacggttggatgcggtattcgccgcgcttgccgatgcacgtacgcgccac
ggcgccgatgcattgggcagctacatcatctcgatggcgcataaccgcgccgacgtcttg
accgtgctggcactggcgcgtcgtggcggcctggtcgacgacgccggcgctgtgccgctg
gatatcgtgccgctgttcgaaaccgtggacgatctgcgtggtggcaccggcaccgtgcag
gacctgctggccgatccggtctatcgccagcatctggccgcgcgcggcgatacccagatg
gtgatgctgggctactcggacagcggcaaggacggcggcatcgccgcctcgcgctggggt
ctgcaacgcgcgcaggtcgagctgctggaagcggccgccgagctgggcgtacggctgacc
ttcttccacggctgtggcggctcgatcgcgcgcggcggcggcaagaccagccgcgcgctg
gatgccgcaccgcgcggcagcgtggatggacgcttgcgcgtcaccgagcagggcgaggtg
atccaccgcaaatatggcattcgcgcattggcgttgcgctcgctggagcagatgaccggc
gcggtgctgctctcgagcctgcgcccgcgtgcgcccgagccgcgggaggcgcgttggcgc
ccggtgatggatctggtggccgaacgcagcacggtcgcgtatcgcgccttcgttggcgcg
ccggagttcatgcagtacttccgcctggccacgccgatcgatgtgatcgaacgcatgacg
ctgggttcgcgcccgtcgcggcggctgggccaggacgcggcgctgtccaacctgcgtgcg
attccatgggtatttgcgtggagccaggcgcgtgcggtgattcccggctggtacggcgtg
ggcagcggcctgcaggcggcggtggatgccgggcatgaagataccttgcgcgaaatggcg
caggactggccgttcttccgcacctttctggacgacatcgccatggtcttgtccaagggc
gatctgaacatcgccgagctgttctcgcgcttgtccggcgacctgcacacgcggtttttc
ccgctgattggcgacgaactggcattgaccaagggctgggtgaaggcgctgctgcaacaa
cgatcgctgttgcagcacgacccgcggctggcgttgtcgatccgcctgcgcaatccctac
atcgacccgatcagcgtgctgcaggtggatctgctgcaacgctggcgcgccaccgatggc
gaagaccaagcgctgctgcgtgcgctggtggcctgcgtcaatggcgtctcgcaaggcgtg
cagaacaccggctga

DBGET integrated database retrieval system