KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr09120Help
Entry
XFF4834R_chr09120 CDS       T03094                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F52a subunit, FAD/NAD(P)-binding
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xfu  Xanthomonas citri pv. fuscans
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XFF4834R_chr09120 (ahpF)
Enzymes [BR:xfu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     XFF4834R_chr09120 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like DAO FAD_binding_3 AlaDh_PNT_C NAD_binding_7 Glutaredoxin FMO-like Thioredoxin_4 K_oxygenase Thi4 NAD_binding_8 Spermine_synth
Motif
Other DBs
NCBI-ProteinID: CDF60540
UniProt: A0A2H1SSJ6
LinkDB All DBs
Position
complement(1050461..1052053)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLTAYLERVTRPIQINASIDDSAGSREMLDLLEELVLLSDKISLDIHRDDNQ
RKPSFALTTPGQDISLRFAGLPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLEGDYR
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGAWFQDEVETRQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNAAKRDAAKIAAKEAFDVLVVGGGPAGSAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGADG
LIEIRLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADEVLQRKLRSLHNVRIITSAQTTEVLGDG
QKVTGLVYKDRTGGDIQHIELEGVFVQIGLLPNTEFLRGTVALSPRGEIIVDDRGQTDVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRTSAPATADSVAQAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaagacccagctgaccgcctacctggaacgggtgacgcggccg
attcaaatcaacgcctcgatcgacgatagtgccggctcgcgcgaaatgctcgacctgctg
gaagagttggtcctgctgtcggacaagatcagcctggacatccaccgcgacgacaaccag
cgcaagccctcgtttgcgttgaccacgccgggccaggacatctcgctgcgctttgccggg
ctgccgatgggccatgagttcacctcgctggtgctggcgctgctgcaggtgggcggccat
ccgtccaaggccgctgccgaactgatcgagcaggtgcagcacctggaaggcgactaccgg
ttcgaaacctatttctcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaac
ctggcagccgtgctcaatccgcgcatcaagcacgtggccatcgatggcgcctggttccag
gacgaagtggaaacccgccagatcatgtcggtgcccaccgtgtacttgaacggcgagctg
ttcgaccagggccgcatgacgctggagcagatcgtcgccaagctcgataccaatgccgcc
aagcgcgacgctgcgaaaatcgctgcaaaggaagcattcgacgtgctggtggtgggcggt
ggcccggctggctcggcggcggcggtctatgccgcacgcaagggcatccgcaccggtgtg
gcggccgaacgattcggcggccaggtgctggacaccatgtcgatcgagaacttcatttcc
gtgccggaaaccgaaggcccgaagatggccgccgcactggagcagcatgtgcgccagtac
gacgtggacatcatgaatctgcagcgtgccgagcagctgatcccggccggtgccgatggc
ctgatcgaaatcaggctggccaatggcgcctcgctcaagagcaagaccgtgatcctgtcc
accggtgcgcgctggaggcagatgaacgtgcctggcgaagaccagtacaagaacaagggt
gtggcgtattgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactcgggcgtggaagcggcgatcgatctggccggcatcgtggcgcatgtc
acgctggtggaattcgacgacaagctgcgcgccgacgaagtgctgcaacgcaagctgcgc
agcctgcacaacgtacgcatcatcaccagcgcgcagaccactgaagtactcggcgacggg
cagaaggtcaccggtctggtctacaaggaccgcaccggcggcgatatccagcacatcgag
ctggaaggcgtgttcgtgcagatcggcctgctccccaacaccgagttcctgcgcggcacg
gtggcgctgtcgccgcgcggcgaaatcatcgtcgacgaccgtggccagaccgatgtaccc
ggcgtgttcgccgctggcgacgccaccacggtgccgtacaagcagatcgtgatcgcaatg
ggcgaaggttccaaggcggcgctgagtgcattcgaccatctgatccgcaccagcgcaccg
gccactgccgacagtgtggcccaggccgcataa

DBGET integrated database retrieval system