KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr25720Help
Entry
XFF4834R_chr25720 CDS       T03094                                 

Definition
(GenBank) putative D-amino acid oxidase
  KO
K21061  D-hydroxyproline dehydrogenase subunit beta [EC:1.5.99.-]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00330  Arginine and proline metabolism
xfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    XFF4834R_chr25720
Enzymes [BR:xfu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     XFF4834R_chr25720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 FAD_oxidored NAD_binding_8 Thi4 Pyr_redox_2 Lycopene_cycl AdoHcyase_NAD Pyr_redox 3HCDH_N HI0933_like GIDA
Motif
Other DBs
NCBI-ProteinID: CDF62072
UniProt: A0A2H1SFZ8
LinkDB All DBs
Position
complement(2981816..2983093)
Genome map
AA seq 425 aa AA seqDB search
MEPQRPAPVLASVTPSGAAVSAAMSGTVAATHASAATPGLAAVAGSGSATSAAYTRRSYD
LIVIGAGIVGAACAEAAAGEGLRVAIVEPGPIGGGSTAAAMGHLVAMDDDPAELALSAYS
LRLWERFAMLSEAEFSRCGTLWVARDARELAAVPAKIARLAMAGLHAEAIDAAQLYALEP
QLVPGLAGGMRVPDEAVVYPPRVARYLVGAACTSGARLFAGRRVVQLQEHAVRLDDGQTL
AGPVLVASGVALPQLLPELALRPRKGHLVITDRHPGLIRHQLLELGYADSAHGADDTSVA
FNVQPRPTGQILIGSSRQFGEHDRALSMPVLQQMLQRAFAYLPVLRELQAIRVWTGLRPA
TPDGRPYLGMVPGRRDVWVAAGHEGLGVTTALGSARVIVDSLLGRTPAIDPAPYAPARAA
QGAPA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggaaccccagcggcccgcgccggtgcttgcgtcggtcacgccgtctggcgcagcagtg
tccgctgcgatgtcagggaccgttgctgcaacgcacgcgtcggcagcgacgcctggattg
gctgcggttgccggatccgggtccgccacgtctgccgcatacacgcgacgcagttacgac
ctgatcgtgatcggcgccggcattgtgggcgccgcgtgcgcggaagcggcggcgggcgag
ggccttcgcgtggcgatcgtcgagccgggaccgatcggcggcggctccaccgcggcggcg
atggggcatttggtggcgatggacgacgacccggccgagctggcgttgtcggcgtattcg
ctgcgcctgtgggagcgcttcgccatgctcagcgaagccgaattcagccgctgcggcacg
ctgtgggtggcccgcgatgcgcgcgaactggcggcggtgcctgccaagatcgcgcgcctg
gcaatggccggcctgcatgccgaagcgatcgatgccgcgcagctgtatgcgctggaacca
cagctggtgcccgggctggctggcggtatgcgcgtgcccgatgaagccgtggtgtatccg
ccgcgggtcgcgcggtacttggtgggcgccgcatgcacgtccggtgcgcgcttgttcgcc
ggccgccgcgtggtgcagctgcaggagcatgcggtgcgtctggacgatgggcagacgctc
gccgggccggtgctggtggccagcggtgtggccttgccgcagttgctgcccgagctggca
ctgcgcccgcgcaagggccatttggtgattaccgaccggcacccggggctgatccggcat
cagctgctggaactgggctatgcggattcggcgcatggggccgacgacaccagcgtggcc
ttcaatgtgcagccgcggcccaccgggcagattctgatcggctcctcgcgccagttcggc
gagcacgaccgcgcattgtcgatgccggtgctgcagcagatgctgcagcgcgccttcgcg
tacctgccggtgctgcgcgaactgcaggcgatccgcgtgtggaccggtttgcgtccggcc
acgccggacgggcgcccgtatttggggatggtgcccggccggcgcgatgtgtgggtggcc
gccggtcacgaggggcttggggtcaccacggcgctggggagcgcacgggtgatcgtggac
agcctgctcgggcgcaccccggccatcgacccggcgccctacgcaccggcgcgtgccgcg
caaggagcgcccgcatga

DBGET integrated database retrieval system