KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr31600Help
Entry
XFF4834R_chr31600 CDS       T03094                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu03030  DNA replication
xfu03410  Base excision repair
xfu03420  Nucleotide excision repair
xfu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:xfu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XFF4834R_chr31600
   03410 Base excision repair
    XFF4834R_chr31600
   03420 Nucleotide excision repair
    XFF4834R_chr31600
   03430 Mismatch repair
    XFF4834R_chr31600
Enzymes [BR:xfu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     XFF4834R_chr31600
    6.5.1.6  DNA ligase (ATP or NAD+)
     XFF4834R_chr31600
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     XFF4834R_chr31600
DNA replication proteins [BR:xfu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    XFF4834R_chr31600
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     XFF4834R_chr31600
DNA repair and recombination proteins [BR:xfu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     XFF4834R_chr31600
   NER (nucleotide excision repair)
    Other NER factors
     XFF4834R_chr31600
   MMR (mismatch exicision repair)
    Other MMR factors
     XFF4834R_chr31600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CDF62613
UniProt: A0A2H1S6J3
LinkDB All DBs
Position
3628055..3629659
Genome map
AA seq 534 aa AA seqDB search
MKRFAALYRTLDRSTGTLDKRAALVAYFRDAPALDSAWALYLLAGGKVASARMRIASSGE
LREWITDTAGIADWLVADSYDHVGDLAETLALLLDDPVTEAADLPLAEWIEQRLLPIANQ
DVEVRKACIVQAWRSLAFDERLAFNKLLTGALRVGVSQRLVQQALAELSGVDIARIAQRM
LGSWRPHPTYLAELLTSEELPGDRQQPYPFFLASPLEAEVETLGAIDDWLLEWKWDGIRL
QLIRRAGEAALWSRGEERLDGRFPEIEHAAMQLPDGTVIDGELLAWQPEQPLPMPFTALQ
TRIQRLKPGPKTLAAAPARVMAYDLLELAGEDLRERPLQERRALLEGVLFALADPRIVAS
PLVQVSDWQAAAQVRVEARERGVEGLMLKRASSMYQSGRRRGDWWKWKIDPLTIDAVLLY
AQAGHGRRSTLYTDYTFGLWHEGQLVPIAKAYSGLDDKEILQLDRWIRANTTERFGPVRA
VTAHHVFELGFEAVNRSARHKSGIAVRFPRILRWRHDKPMAEADHLSTLQALAR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgtttcgcggcgttgtaccgcaccctggatcgcagcaccggtacgctcgacaag
cgcgcggcactggtcgcgtatttccgcgatgcacccgcgctggactcggcatgggcacta
tacctgctggccggtggcaaggtggccagcgcacgcatgcgcattgccagcagcggcgaa
ctgcgtgaatggatcaccgacaccgccggcattgccgactggctggtcgccgacagctac
gaccatgtcggcgatctggccgaaaccctggccttgctgctggacgacccggtcaccgag
gcggccgatctgccattggccgagtggatcgaacagcgcctactgcccatcgcaaatcag
gacgtggaagtgcgcaaggcctgcatcgtgcaggcatggcgcagcctggccttcgacgag
cgtctggcattcaacaagctgctcaccggcgcgctgcgcgtgggcgtgtcgcagcgactc
gtgcagcaggcgctggccgaattgtcgggtgtggatatcgcgcgcatcgcgcagcgcatg
ctcggcagttggcggccgcatccgacctatcttgcagagctgttgaccagcgaagaactg
cctggcgatcgccagcagccttacccgttcttcctggcatcgccgctggaggcagaggtc
gagacgctgggcgccatcgatgactggctgctggaatggaaatgggacggcattcgcctg
caactgattcgccgcgccggcgaagcggcgctgtggtcgcgcggcgaagaacgtctggat
ggacgttttcctgaaatcgaacacgccgcaatgcaattgccggacggcaccgtcatcgat
ggcgagctgctggcctggcaacccgaacagcccctgccaatgccgtttaccgcgttgcag
acgcgcatccagcggctcaagcccgggcccaagaccttggccgccgcaccggcgcgcgtg
atggcctacgacctgctggaactggcgggcgaagacctgcgcgagcgcccgctgcaggag
cggcgcgcactgctggaaggcgtgctcttcgcgctcgcagacccgcgcatcgttgcctcg
cccctggtgcaggtcagcgattggcaggccgcagcgcaggtgcgcgtggaagcgcgcgaa
cgcggcgtggaagggctgatgctcaagcgcgccagttcgatgtatcagtccggtcgccgt
cgcggcgactggtggaaatggaagatcgacccgctgaccatcgacgcggtgctgttgtac
gcgcaagccggccacggccgacgcagcacgctctacaccgactacaccttcgggctgtgg
catgagggccagctggtgccgatcgccaaggcgtattcgggcctggacgacaaggaaatc
ctgcagctcgatcgctggatccgtgccaacaccaccgagcgtttcggcccggtgcgcgcg
gtcaccgcgcatcatgtgttcgagctggggtttgaagcggtgaaccgcagcgcgcggcac
aaatccggcatcgcggtgcgcttcccacgcattctgcgttggcgtcacgacaagccgatg
gccgaagccgaccacttgagtaccctgcaggcactggcacggtga

DBGET integrated database retrieval system