KEGG   Xanthomonas citri pv. fuscans: XFF4834R_chr35210Help
Entry
XFF4834R_chr35210 CDS       T03094                                 

Gene name
fabB
Definition
(GenBank) probable 3-oxoacyl-[acyl-carrier-protein] synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
xfu  Xanthomonas citri pv. fuscans
Pathway
xfu00061  Fatty acid biosynthesis
xfu00780  Biotin metabolism
xfu01100  Metabolic pathways
xfu01212  Fatty acid metabolism
Module
xfu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:xfu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    XFF4834R_chr35210 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    XFF4834R_chr35210 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:xfu01004]
    XFF4834R_chr35210 (fabB)
Enzymes [BR:xfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     XFF4834R_chr35210 (fabB)
Lipid biosynthesis proteins [BR:xfu01004]
 Fatty acid synthase
  Component type
   XFF4834R_chr35210 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: CDF62949
UniProt: A0A2H1SH41
LinkDB All DBs
Position
4088725..4089933
Genome map
AA seq 402 aa AA seqDB search
MRRVVITGMGITSCLGNDLDTVSSALRESRSGITALPDHAEAGLRSQVGGAVALDLDSLI
DRKLKRFMGDASAYAYLAMRDAIADAGLDAEQVSGLRTGVIAGSGGGSSQWQVETADLLR
NRGVRKVGPYMVPRTMCSSVSASLATAFKIRGLSYSLSAACATSAHCIGAAADLIRHGAQ
DVMFAGGGEELHWTMSVMFDAMGALSTGFNDRPAVASRPYDAQRDGFVIGSGGGMLVLED
YDHAIARGARIHAELLGYGVTSDGADMVAPSGEGAVRCMHMAMQGLQRPIDYLNTHGTST
PLGDVTELGAVREVFGDDVPPLSSTKGLSGHSLGAASVHEAIYSLLMLRDGFMAGSAHID
ELDPRAEGFPILRQTQDATLNTVMSNSFGFGGTNATLVFGRT
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcgtcgtcattaccggaatgggcatcacctcatgcctgggcaacgatctggac
accgtctccagcgcactgcgcgagagccgctctggcatcaccgcgctgcccgatcacgcc
gaggcaggcctgcgtagccaggtcggcggtgcggtggcgctggatctggacagcctgatc
gaccgtaagctcaagcgcttcatgggcgatgcctcggcttacgcatacctggcaatgcgc
gatgcgatcgccgatgcgggcctggatgccgagcaggtcagcggtctgcgtaccggcgtg
attgccggctccggtggcggctccagccaatggcaggtggaaaccgccgatctgctgcgc
aaccgtggcgtgcgcaaggtgggcccatacatggtgccgcgcacgatgtgttcgtcggtg
tccgcatcgctagccactgcgttcaaaatacgcgggctgagctactcgctgtcggccgcg
tgcgcgacgtctgcgcattgcatcggtgcggcggcagatctgatccggcatggcgcacag
gacgtgatgttcgccggtggcggcgaagaactgcactggacgatgagcgtgatgttcgat
gcgatgggcgcgctgtccaccggtttcaacgatcgccccgccgtggcctcgcgcccgtac
gatgcgcagcgcgatggcttcgtcatcggcagcggcggcggcatgctggtgctggaagac
tacgatcacgccatcgcacgcggcgcacgcatccatgccgaactgctcggctatggcgtg
acctccgacggtgccgatatggtcgcgcccagcggcgaaggcgccgtgcgctgcatgcac
atggccatgcaggggctgcagcgtcccatcgattacctcaacacgcatggcacgtccacg
ccgctgggcgatgtcaccgaactgggcgcggtgcgcgaggtattcggcgacgacgtgccg
ccgctgtcttcgaccaaggggctctccgggcactcgctgggcgcggccagcgtgcacgag
gcgatctacagcctgctgatgctgcgcgatggcttcatggccggctcggcgcatatcgac
gaactcgatccgcgcgccgaaggctttccaatcttgcggcagacgcaggacgcgaccttg
aacacggtgatgtccaacagtttcggctttggtggcaccaacgcgacactggtcttcgga
cgcacctaa

DBGET integrated database retrieval system