KEGG   Xanthomonas gardneri: BI317_05230Help
Entry
BI317_05230       CDS       T04668                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xga  Xanthomonas gardneri
Pathway
xga00010  Glycolysis / Gluconeogenesis
xga00053  Ascorbate and aldarate metabolism
xga00071  Fatty acid degradation
xga00280  Valine, leucine and isoleucine degradation
xga00310  Lysine degradation
xga00330  Arginine and proline metabolism
xga00340  Histidine metabolism
xga00380  Tryptophan metabolism
xga00410  beta-Alanine metabolism
xga00561  Glycerolipid metabolism
xga00620  Pyruvate metabolism
xga00625  Chloroalkane and chloroalkene degradation
xga00903  Limonene and pinene degradation
xga01100  Metabolic pathways
xga01110  Biosynthesis of secondary metabolites
xga01120  Microbial metabolism in diverse environments
xga01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BI317_05230
   00053 Ascorbate and aldarate metabolism
    BI317_05230
   00620 Pyruvate metabolism
    BI317_05230
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BI317_05230
   00561 Glycerolipid metabolism
    BI317_05230
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BI317_05230
   00310 Lysine degradation
    BI317_05230
   00330 Arginine and proline metabolism
    BI317_05230
   00340 Histidine metabolism
    BI317_05230
   00380 Tryptophan metabolism
    BI317_05230
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BI317_05230
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BI317_05230
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BI317_05230
Enzymes [BR:xga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BI317_05230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APP83676
UniProt: A0A1L5XZJ4
LinkDB All DBs
Position
complement(1168726..1170195)
Genome map
AA seq 489 aa AA seqDB search
MEALSATLRGIAARGPLGLFIDGQWRASTGDRHVDVIAPHTEERLLRYTEPSSADTDAAV
AAARAAFDSGPWPQLSPPERGVVLKRVAEHLRARMPELAEAWTGQVGATIGFSRRASQQA
PGLFDYYGDLIATHPFVEPRARANGGRVHVVQEPVGVVAAITPWNAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPDGVFNLLPAGREVGEQLIRHPQVDKVSFTG
STQAGRAIGVACAQRLARVGLELGGKSAAIVLDDADLAKVLPSLVPYSMPITGQVCFALT
RVLVPAQRREEILQAYCAALSALKLGDPFAADTGMGPLALGRQLERVQSYIAQGSAEGAR
LVMGGGRPTHLPRGFFIEPTVFAEVTPDMTIAREEIFGPVVSFIDYHDDADLIAKVNASD
FGLHGTVYSEDPERAYRIARRVRSGSHCINGMWVDIEMPFGGFKNSGIGREGGIEGLHAF
LETRTIYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttgtccgcaaccctgcgcgggatcgccgcgcgtgggcctttgggtctgttc
atcgatggtcagtggcgcgccagcaccggcgatcgccatgtcgatgtgatcgcgccgcac
accgaagagcgcctgctgcgttacaccgaaccctcctctgccgataccgatgcagcagtc
gctgctgcgcgtgccgcgttcgacagcggcccctggccacaactgtcgccgcccgaacgt
ggcgtggtgctcaagcgcgttgccgaacacctgcgtgcacgcatgccggaactggccgag
gcctggaccggccaggtcggcgccaccatcggcttcagccgccgcgcctcgcagcaagcg
cccggcctgttcgattactacggcgacctgatcgccactcatccgttcgtggagccgcgt
gcacgcgccaacggtggccgcgtgcatgtcgtgcaagaaccggtcggcgtggtcgcagcg
atcacgccatggaacgccccattggtgctgctctgctacaaggtcgccgccgcattggcc
gccggttgcacggtggtggccaagccctccccggaaacgccgatcgatgcctacatcctg
gccgaatgcatcagcgccgccggtgtccccgatggcgtgttcaatctgttgccggccggt
cgcgaggtcggcgaacagctgatccgtcatccgcaggtggacaaggtgagctttaccggt
tccacccaggcgggccgagcgatcggcgttgcctgtgcgcagcggttagcgcgggtcggg
ctggaactgggcggcaaatccgcagcgatcgtgctcgacgatgccgatctggccaaggtg
ctgcccagcctggtgccctactccatgccgatcaccggccaggtgtgcttcgcgctcacc
cgcgtgctggtgccggcgcagcggcgcgaagagatcctgcaggcgtattgcgcggccttg
agtgcgctcaagctcggcgacccgttcgctgccgataccggcatgggcccgttggcgctt
ggccgccagctcgagcgcgtgcagtcctacatcgcgcaaggcagcgccgagggtgcgcgc
ctggtcatgggtggcggtcgtccgacgcacttgccgcgcggtttctttatcgagccaacg
gtatttgccgaggtgacaccggacatgaccatcgcgcgcgaagagatcttcggcccggtg
gtcagctttatcgattatcacgacgacgccgacctgatcgccaaggtcaatgccagcgac
ttcggtctgcacggcacggtctacagcgaagatcccgagcgcgcgtatcgcatcgcacgc
cgcgtgcgcagcggcagccattgcatcaatggcatgtgggtggatatcgagatgccattc
ggtgggttcaaaaattccggtatcggccgcgaaggcggtatcgaaggcctgcacgcattt
cttgaaaccaggaccatttatctcagttag

DBGET integrated database retrieval system