KEGG   Xanthomonas gardneri: BI317_05355Help
Entry
BI317_05355       CDS       T04668                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xga  Xanthomonas gardneri
Brite
KEGG Orthology (KO) [BR:xga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BI317_05355
Enzymes [BR:xga01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BI317_05355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO Glutaredoxin FAD_binding_3 AlaDh_PNT_C NAD_binding_7 FMO-like Thi4 Thioredoxin_4 K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: APP83698
UniProt: A0A1L5XZM4
LinkDB All DBs
Position
complement(1191429..1193021)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLTAYLERVTRPIQINASIDESAGSREMLDLLEDLVLLSDKISLDIHRDDNQ
RKPSFALTTPGQDISLRFAGLPMGHEFTSLVLALLQVGGHPSKATAELIEQVQHLDGDYQ
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGSLFQEEVETRQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNAAKRDAVKIAAKDAFDVLVIGGGPAGSAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQVIPAGADG
LIEIKLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEYDDKLRADEVLQRKLRSLHNVRIITSAQTTEVLGDG
QKVTGLVYKDRTGGDIQHVDLEGVFVQIGLLPNTEFLKGAVALSPRGEIIVDDRGQTNLP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRSSAPVSAEVVAEAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaacctcaagacccagctgaccgcctacctggaacgggtcacgcggccg
attcagatcaatgcctcgatcgacgagagcgccggctcgcgcgagatgctcgacctgctc
gaagatctggtgctgctgtcggacaagatcagtctggacatccaccgcgacgacaaccaa
cgcaagccgtcgttcgcgttgaccacgcccggccaggacatctcgctgcgcttcgccggc
ctgccgatgggccacgagttcacctcgctggtgctggcgctgctgcaggtcggcggccac
ccctccaaggccaccgccgagctgatcgagcaggtgcagcatctggatggcgactaccag
ttcgaaacctatttctcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaat
cttgccgccgtgctcaacccgcgcatcaagcacgttgccatcgacggctcgctgtttcag
gaagaagtcgaaacccgccagatcatgtcggtgcccaccgtctacttgaacggcgaattg
ttcgaccagggccgcatgacgctggagcagatcgtcgccaagctcgacaccaacgctgca
aagcgcgacgcggtcaagattgcggccaaggacgccttcgacgtgctggtgatcggcggt
ggcccggccggttcggcagcggcggtgtatgccgcacgcaagggcatccgcaccggcgtg
gccgccgagcgtttcggtggccaggtgctggacaccatgtcgatcgaaaacttcatctcg
gtgccggaaaccgaaggcccgaaaatggcagccgcgctcgagcagcacgtgcgccagtac
gatgtggacatcatgaatctgcagcgtgccgagcaggtgattccggccggtgccgatggc
ctgatcgagatcaagctcgccaatggcgcctcgctcaagagcaagaccgtgatcctgtcc
accggcgcacgctggaggcagatgaacgtgccgggcgaagatcagtacaagaacaagggc
gtggcctattgcccgcattgcgatggcccgctgttcaagggcaagcgcgtggcggtgatc
ggtggcggcaattcgggcgttgaggccgcgatcgatctggccggcatcgtggcgcatgtc
acgctggtggaatacgacgacaagctgcgcgccgacgaagtgctgcaacgcaagctgcgc
agcctgcacaacgtgcgcatcatcaccagcgcgcagaccaccgaagtgctgggcgatggc
cagaaggtcaccggcctggtctacaaggaccgtaccggcggcgacatccagcatgtcgat
ctggaaggcgtgttcgtacagatcggcctgctgcccaataccgagttcctcaagggtgcg
gtggcgttgtcgccgcgcggcgagatcatcgtcgacgaccgtggccagaccaatctcccc
ggcgtgttcgccgccggcgacgccaccacggtgccgtacaagcagatcgtgatcgcgatg
ggcgaaggttccaaggctgcactgagcgcgttcgattacctgatccgctccagtgcaccg
gtcagcgccgaggttgtggctgaggccgcataa

DBGET integrated database retrieval system