KEGG   Xanthomonas gardneri: BI317_10885Help
Entry
BI317_10885       CDS       T04668                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xga  Xanthomonas gardneri
Pathway
xga00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xga00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BI317_10885
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xga02000]
    BI317_10885
Enzymes [BR:xga01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BI317_10885
Transporters [BR:xga02000]
 Other Transporters
  Pores ion channels [TC:1]
   BI317_10885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: APP84591
UniProt: A0A1L5Y265
LinkDB All DBs
Position
2354812..2355510
Genome map
AA seq 232 aa AA seqDB search
MITVHHLNNSRSQRVLWLLEEMALPYQIVRHERDPKTMLAPAALRAIHPLGKSPLIVDGD
LTVAESGAIMEYLTERYDTECALSPSPRPQDSPERMQFRYWMHYAEGSAMPPLLMTLIFA
RIRSAPMPFFVKPIARAIADKAMSGFVSPQLKLHLDWMEQSLQASNWFAGERFTAADIQM
SFPVQAAAARGGGFENYPRLRAFLERIEARPAYQAALKKGGPFELMGRKSPE
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgtccaccatctcaataattcccgttcccagcgcgtgctgtggctgctggaa
gaaatggcgctgccgtaccagatcgtgcggcatgagcgcgaccccaagaccatgctggcg
cctgccgcattgcgtgcgatccatccgctgggcaaatcgccgctgattgtggatggcgat
ctgaccgtggccgagtccggcgcgatcatggagtacctgaccgaacgctacgacaccgaa
tgcgccctgtcgccatcgccgcgtccgcaggattcgccggagcgcatgcagtttcgctac
tggatgcattacgccgaaggctcggcgatgccgccattgttgatgacgctgatcttcgcg
cgcattcgcagtgcgccgatgccgtttttcgtcaagcccattgcacgcgcgattgcggac
aaggcgatgtcgggcttcgtcagcccgcaactcaagctgcatctggattggatggagcaa
tccctgcaggccagcaactggttcgccggtgagcgctttactgcggccgacatccagatg
agctttccggtgcaggccgccgcggcgcgtggcggcgggtttgaaaattatccgcgtttg
cgcgcgtttctggagcggatcgaagcgcgtccggcgtatcaggcggcgctgaaaaagggc
ggcccgttcgagctgatgggacgcaagtccccagagtaa

DBGET integrated database retrieval system