KEGG   Xanthomonas gardneri: BI317_15190Help
Entry
BI317_15190       CDS       T04668                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
xga  Xanthomonas gardneri
Pathway
xga00380  Tryptophan metabolism
xga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BI317_15190
Enzymes [BR:xga01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BI317_15190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: APP85310
UniProt: A0A1L5Y493
LinkDB All DBs
Position
3280969..3282240
Genome map
AA seq 423 aa AA seqDB search
MTDPLSRAHAVALDAADPLRSLRDAFVFPQHGGQDQTYFVGNSLGLQPRAARAMVAEVLD
QWGALAVEGHFTGPTQWLTYHQLVRDGLARVVGALPGEVVAMNTLSVNLHLMMASFYRPT
PERGAILIEAGAFPSDRHAVESQLRLHGLDPATHLIEVEADEPNGTLSMAAIAEAIALHG
SRLALVLWPGIQYRTGQAFALGDIARLARAQGAAVGFDLAHAVGNIPLTLHDDGVDFAVW
CHYKYLNAGPGAVGGCFVHERHANSDLPRMAGWWGHEQQTRFRMDPQFVPSPGAEGWQLS
NPPVLALAPLRASLDVFDQAGMPALRAKSEQLTGHLEQLIHTRVPQVLQIVTPSDPAQRG
CQLSLRVAGGRAQGRSLFEYLQSVGVLGDWREPDVIRIAPVPLYNRFCDLHRLVEQVETW
AAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccgctgtcccgcgcccatgccgttgcactggacgccgccgacccgctacgc
agcctgcgcgatgcgttcgtgttcccgcagcatggcggccaggatcagacctatttcgtc
ggcaattcgctgggcctgcagccgcgcgccgcgcgcgcaatggtggccgaagtgctcgac
cagtggggcgcactcgcagtggaaggccacttcaccggccccacgcaatggctgacgtat
caccaattggtgcgtgatggcctggcacgtgtggtcggtgcactgcccggcgaagtggtc
gcgatgaacacgctgagcgtcaacctgcatctgatgatggccagcttttaccgccccacg
cccgagcgcggcgcgatcctgatcgaagccggtgcgtttccgtccgaccgccatgcggtg
gaatcgcaactgcgcctgcatgggctggatccggccacgcacctgatcgaagtggaagcc
gatgagcccaacggtaccttgtcgatggcggcgattgccgaagccatcgcattgcatgga
tcgcgtctggcgttggtgctgtggcccggcatccagtaccgcaccggccaggccttcgcg
ctgggcgacatcgcgcgtttggcgcgcgcgcaaggcgccgcggtgggtttcgatctggcg
catgcggtcggcaatatcccgctgacgctgcacgacgatggcgtggatttcgcggtgtgg
tgccactacaaatatctcaacgccgggcccggtgcggtgggcggttgtttcgtgcacgaa
cgccatgccaacagcgacctgccgcgcatggccggttggtgggggcacgaacagcagacc
cgcttccgcatggacccgcagttcgtgccctcgccaggtgccgaaggctggcagctgagc
aatccgccggtactggcgctggccccgctgcgtgcgtcgcttgatgtgttcgaccaggcc
ggcatgccggcgttgcgtgcgaaatccgaacagctcaccggccatctggaacagctgatc
cacacacgcgtgccgcaggtgctgcagatcgtcaccccgtccgaccctgcgcagcgcggt
tgccagctgtcgctgcgggtggccggcgggcgggcgcaagggcgctcgctgttcgagtat
ctgcagtcggtcggcgtgcttggcgactggcgcgagccggacgtgatccgcatcgcaccg
gtgccgctgtacaaccgcttctgcgatctgcatcggttggtcgagcaggtggaaacctgg
gccgccgcctga

DBGET integrated database retrieval system