KEGG   Xanthomonas gardneri: BI317_22445Help
Entry
BI317_22445       CDS       T04668                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
xga  Xanthomonas gardneri
Pathway
xga00970  Aminoacyl-tRNA biosynthesis
xga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xga00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BI317_22445
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:xga03029]
    BI317_22445
Enzymes [BR:xga01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BI317_22445
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BI317_22445
Mitochondrial biogenesis [BR:xga03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BI317_22445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: APP86474
UniProt: A0A1L5Y7I5
LinkDB All DBs
Position
4934231..4935691
Genome map
AA seq 486 aa AA seqDB search
MQLPAQWQAGIDRNTEVLRGHAQLLASFTAPRPASPDTTTPRGQIASIVSTTRSQPTLTA
RHANQTLTHIHQANDSLRAITRLLPARAAADAARVQAALAGGSDGGALAGVPFVVKDLFD
VAGEVTTAGAVVRAQCAPATRDAAVVQRLSDAGAVLVGTANMDEFAYGFATVNAHYGTTA
NPHDHRHLAGGSSGGSAAAVAAGLVPFALGSDTNGSIRVPAALCGVYGLRPTHGALPLDG
VFGFVDALDVVGPFATSIADLRRVYEVMLGHSVASCNPGSLRIARLGGWFQRNLDPDLDA
GLSALLTACNSTTLIELPEAERARAAAFVLTAAEGGHRHRAGLSTHAEQFDPATRDRLLA
GLQLPASAVADAHRFAQWFGAAMQRLWDEVDVLIAPTTPCVAPRIDQDTIQIDGLPVSAR
ANLGIFTQPLGLAACPVLAAPLPRPGRLPLGVQLIAAPGREDRLFALAAQLERDGLLAFS
PPAETR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcccagcgcagtggcaggccggcatcgatcgcaataccgaggtcctgcgcggc
cacgcgcagctgctcgccagcttcaccgccccgcgccccgcatcaccggacacaaccact
ccgcgcgggcagatcgcctccatcgtcagcaccacccgcagccagcccacgctgaccgca
cgccatgccaaccagacactcacgcacatccaccaggccaacgacagcctgcgtgcgatc
acccgcctattgcctgcacgcgccgccgccgatgccgcgcgcgtgcaggccgcgctggcc
ggcggcagcgacggcggcgcgttggccggcgtgccgttcgtggtcaaggatctgttcgat
gtcgctggtgaggtcaccaccgctggtgccgtcgtgcgcgcgcaatgcgcacctgccacc
cgcgatgcggctgtggtgcaacggctgagcgatgcgggcgcggtgctggtgggcactgcc
aacatggacgaattcgcctacgggtttgccaccgtcaacgcgcattacggcaccaccgcc
aacccgcacgatcaccgccatctggccggtggttcgtcgggcggctcggctgctgcggtg
gccgccgggctggtgccattcgcgctcggctcggacaccaacggctccatccgcgttccg
gccgcactatgcggcgtgtatggcctgcgccccacgcatggcgcgttgccgctggacggc
gtgttcggcttcgtcgatgcgctggatgtggtcggcccgttcgccacctccatcgccgat
ctacgccgcgtctatgaagtgatgcttggtcactccgttgcctcctgcaatcccggcagc
ttgcgcatcgcacgcctgggcggctggttccaacgcaatctcgaccccgatctggatgcc
ggcctcagcgcattgctcaccgcctgcaacagcaccaccctcatcgaattacccgaagca
gaacgcgcccgcgccgccgccttcgtgctcaccgctgccgaaggcggccaccgtcatcgc
gccggtttgagcacgcatgccgagcagttcgacccggccacccgcgaccgcctgctcgcc
ggcctgcaattgcctgccagcgcggtggccgatgcacaccgcttcgcgcagtggtttggc
gccgccatgcaacgcctgtgggacgaggtggatgtgctgatcgcgcctaccacaccgtgc
gtggcaccacgcatcgaccaggacaccatccagatcgacggcctgccggtgtccgcgcgc
gccaacttaggtatcttcacccaaccgctcgggcttgccgcctgcccggtattggccgcc
ccgttgccgcgccccggccgcctgccgctgggcgtgcaattgattgccgcgcccggccgc
gaagaccgcctgttcgcactggcggcgcaactcgaacgcgacggcctgctcgccttcagt
ccaccggcggagacacgctga

DBGET integrated database retrieval system