KEGG   Xenorhabdus hominickii: A9255_03905Help
Entry
A9255_03905       CDS       T04538                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
xho  Xenorhabdus hominickii
Pathway
xho00250  Alanine, aspartate and glutamate metabolism
xho00410  beta-Alanine metabolism
xho00640  Propanoate metabolism
xho00650  Butanoate metabolism
xho01100  Metabolic pathways
xho01120  Microbial metabolism in diverse environments
Module
xho_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:xho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A9255_03905
   00650 Butanoate metabolism
    A9255_03905
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9255_03905
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A9255_03905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xho01007]
    A9255_03905
Enzymes [BR:xho01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A9255_03905
Amino acid related enzymes [BR:xho01007]
 Aminotransferase (transaminase)
  Class III
   A9255_03905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOM39795
UniProt: A0A2G0Q2Y3
LinkDB All DBs
Position
819701..820987
Genome map
AA seq 428 aa AA seqDB search
MTESMLAKRRSEAIAKGVGVTTQVYVERAENAEIWDAQGQRYIDFSAGIAVVNTGHCHPR
VIAAARDQMEKFLHTCHQVVPYENYIALAERLNRLVPGNFVKKTVFVTTGAEAVENAVKI
ARAATGRSGVVAFSGAFHGRTFLGMSLTGKVAPYKMGFGPLVNDVYRVPFPVELHGISVE
QTLNALENLFKTEIEPTRVAAIIIEPVQGEGGFYPAPSELLKSLREIADRYGIVFIADEI
QTGFARTGKLFAMEHHEVVADLTTMAKGLAGGLPLAAVTGRAELMDSVVPGGLGGTYGGN
PVAIAASHAVLDVIEEEKLATRATQLGERLKHCLHGLRPRVPQIADVRGLGLMIAVEFNR
ADSQEPDAGFTNTVRQKALERGLILLTCGVHGNVIRFLPPLTIQNDIFDEALNILESVLL
DLNCKEGK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtcaatgttagctaaaaggcgcagcgaggctatcgcaaaaggtgttggcgtg
accacacaagtttatgttgagcgtgcggaaaatgctgaaatctgggatgctcaggggcaa
cgctatattgatttttccgccggtatcgctgtggtgaataccggtcactgccacccgcgt
gttattgccgcagccagagatcagatggagaagtttctccatacctgtcatcaggtagtg
ccttatgaaaattatatagcactagccgaacgactgaaccgtctggtgcccggtaatttt
gtaaagaagaccgtttttgttaccaccggggctgaggcagtagaaaatgccgtgaagatc
gcgcgtgcggctaccgggcgcagcggcgtggtggctttcagcggcgcttttcatggacgt
accttcctcggtatgtcattaaccggcaaagtcgcgccgtacaaaatggggttcggcccg
ctggttaacgacgtttaccgtgtcccgtttccggtagaactgcacggtatcagcgtggaa
cagacgctgaatgcactggagaatctcttcaaaaccgagattgagcccacacgcgtcgcc
gccatcatcatcgaaccggtacagggcgaaggcggtttctatcctgcgccttccgaactg
ctcaaatccctacgcgaaattgccgatcgctacggtattgtattcattgccgatgagata
cagacgggtttcgcgcgtacgggaaaattgtttgctatggaacatcatgaggttgtggct
gatctgaccacaatggcaaaaggtctggcagggggattgccgctggcggctgtaacggga
cgagcagagttgatggactctgtggtgccgggtggtttggggggaacctatggaggtaac
ccggtggcgattgcggctagccacgcagtgctggatgtgatcgaagaagagaagctggct
acgcgtgcgacgcagttgggggagcggttaaaacactgtctgcatgggctgcggccacgt
gtcccgcagatcgccgacgtgcgtgggcttgggctaatgattgcggtggagtttaaccgt
gcagacagtcaggaacccgatgccggttttaccaatactgtgcgtcagaaagcgctagag
cgaggcctcattctgttgacgtgcggtgtacacggtaacgtgatccgttttcttccaccg
ctgaccatacaaaatgatatttttgacgaggcgcttaacattctggaatctgtgctgctc
gatctgaactgtaaagaaggaaagtaa

DBGET integrated database retrieval system