KEGG   Xenorhabdus hominickii: A9255_14565Help
Entry
A9255_14565       CDS       T04538                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
xho  Xenorhabdus hominickii
Brite
KEGG Orthology (KO) [BR:xho00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:xho03012]
    A9255_14565
   03029 Mitochondrial biogenesis [BR:xho03029]
    A9255_14565
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xho04147]
    A9255_14565
Translation factors [BR:xho03012]
 Eukaryotic Type
  Elongation factors
   A9255_14565
 Prokaryotic Type
   A9255_14565
Mitochondrial biogenesis [BR:xho03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A9255_14565
Exosome [BR:xho04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A9255_14565
  Exosomal proteins of breast cancer cells
   A9255_14565
  Exosomal proteins of colorectal cancer cells
   A9255_14565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AOM41680
UniProt: A0A2G0QEG6
LinkDB All DBs
Position
complement(3167360..3168544)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAVLVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIIRGSALKALE
GEAEWEAKIIELAEALDSYIPEPERDIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
DEVAIVGIKETAKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEIERGQVLAKPGSIQ
PHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNINMI
VTLIAPIAMDEGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgttcaaaaccgcacgttaacgttggtactatcggccac
gttgaccacggtaaaactaccctgactgctgcaatcaccactgttctggcgaaaacttac
ggcggtaacgctcgtgcattcgatcagatcgataacgcaccagaagaaaaagcgcgtggt
atcaccatctctacttctcacgtagaatacgataccccaactcgccactacgcgcacgtt
gactgcccaggtcacgccgattatgtaaaaaacatgatcaccggtgctgctcagatggat
ggtgcagttttggttgttgccgcaactgatggcccaatgccacagactcgtgagcacatc
ctgttgggtcgtcaggtaggcgttccatacatcatcgtgttcctgaacaaatgtgacatg
gttgatgatgaagaactgctggaactggttgagatggaagtccgtgagctgctgtctcag
tacgatttcccaggcgatgatacgccaatcatccgtggttctgctctgaaagcgctggaa
ggcgaagcagagtgggaagcaaaaatcatcgaactggcagaagcactggattcttacatt
ccagaaccagagcgtgacattgacaagccattcctgttgccaatcgaagacgtattctcc
atttctggccgtggtactgtagttaccggtcgtgttgagcgtggtatcgttaaagtgggt
gacgaagttgcaatcgttggtatcaaagagactgcgaaaacaacttgtactggcgttgaa
atgttccgcaaactgctggatgaaggccgtgcgggtgagaacgttggtgttctgctgcgt
ggtactaagcgtgacgaaatcgaacgtggtcaggtactggctaaaccaggttcaatccag
ccacatacgactttcgaatcagaagtgtatatcctgagcaaagatgaaggtggccgtcat
actccattcttcaaaggttaccgtccacagttctacttccgtacaactgacgtaaccggt
actatcgaactgccagaaggcgttgagatggtaatgccaggcgataacattaacatgatc
gtgactctgattgctccaatcgcaatggacgaaggtctgcgtttcgcaattcgtgaaggt
ggccgtactgtaggcgcaggtgttgttgctaaagttattgcttag

DBGET integrated database retrieval system