KEGG   Xenorhabdus hominickii: A9255_15570Help
Entry
A9255_15570       CDS       T04538                                 

Definition
(GenBank) Hsp33 family molecular chaperone
  KO
K04083  molecular chaperone Hsp33
Organism
xho  Xenorhabdus hominickii
Brite
KEGG Orthology (KO) [BR:xho00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xho03110]
    A9255_15570
Chaperones and folding catalysts [BR:xho03110]
 Heat shock proteins
  HSP33
   A9255_15570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AOM41850
UniProt: A0A2G0QF03
LinkDB All DBs
Position
3396034..3396906
Genome map
AA seq 290 aa AA seqDB search
MTKHDQLHRFLFESHFVRGELVSVSETYQRMLENHHFPQPVQQLLGELLVATSLLTATLK
FNGDITVQIQGDGPVKLAVINGNNQQQMRGTARIDGDVNAAGSLRDMIGNGYMVITVTPT
EGERYQGVVALEGETLVECLDAYFKQSEQLSTRLFIRTGMQDGKMTAGGMLLQILPGAQE
GSDNMLDHLAQLTATIKGEELFTLGAEEILHRLYHEEDITLYEPQQVEFRCTCSQQRCAD
TLVTLPDADLQEVLHNDGKIDMECEFCGMHYIFDEKDINEIKSIKKEQLH
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcatgaccaattacaccgctttttgtttgaaagccactttgtcagaggggaa
ctcgtttccgtcagtgaaacttaccagcggatgctggaaaatcatcatttccctcaacct
gtacagcaattattgggtgagttgttggtcgcaaccagcctgctgacggctaccctgaaa
ttcaacggagatattacggtacagattcagggtgatgggccggtcaaactggcggtgatt
aatggtaataaccagcagcagatgcgtggtactgcccgcattgatggtgatgtgaatgcc
gcgggtagcctacgggacatgataggcaatggttatatggtcatcactgtgacaccaaca
gaaggtgagcgttatcagggagttgtggcattagagggagaaacgctggtggaatgtctg
gatgcgtacttcaagcaatccgaacagttgtcgactcgtttgtttatccgcaccggaatg
caggatggaaaaatgaccgcaggtggcatgttattgcagatcctgccgggtgcacaggaa
ggtagtgataatatgcttgaccatctggcacagctcactgcaaccattaagggagaagag
ttgtttacgctgggcgcagaagagattttgcatcgactttatcatgaagaagacattacg
ctatatgaacctcagcaggttgaattccgctgcacctgttctcaacaacgttgtgctgat
acgctggtaacattaccggatgctgaccttcaggaagttttgcacaacgatggaaaaatc
gatatggaatgtgaattctgcggtatgcattatattttcgatgagaaagatatcaatgaa
atcaagtcaataaaaaaagaacaattgcactga

DBGET integrated database retrieval system