KEGG   Xanthomonas hortorum: XJ27_01350Help
Entry
XJ27_01350        CDS       T05082                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
xhr  Xanthomonas hortorum
Pathway
xhr00380  Tryptophan metabolism
xhr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    XJ27_01350
Enzymes [BR:xhr01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     XJ27_01350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ASW44763
UniProt: A0A248Y5F4
LinkDB All DBs
Position
complement(319546..320817)
Genome map
AA seq 423 aa AA seqDB search
MTDPLSRAHAVALDAADPLRSLRDAFVFPQHGGQDQTYFVGNSLGLQPRAARAMVAEVLD
QWGALAVEGHFTGPTQWLTYHQLVRDGLARVVGALPGEVVAMNTLSVNLHLMMASFYRPT
PERGAILIEAGAFPSDRHAVESQLRLHGLDPATHLIEVEADEPNGTLSMAAIAEAIALHG
SRLALVLWPGIQYRTGQAFALGDIARLARAQGAAVGFDLAHAVGNIPLTLHDDGVDFAVW
CHYKYLNAGPGAVGGCFVHERHANSDLPRMAGWWGHEQQTRFRMDPQFVPSPGAEGWQLS
NPPVLALAPLRASLDVFDQAGMPALRAKSEQLTGHLEQLIHTRVPQVLQIVTPSDPAQRG
CQLSLRVAGGRAQGRSLFEYLQSVGVLGDWREPDVIRIAPVPLYNRFCDLHRLVEQVETW
AAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccgctgtcccgcgcccatgccgttgcactggacgccgccgacccgctacgc
agcctgcgcgatgcgttcgtgttcccgcagcatggcggccaggatcagacctatttcgtc
ggcaattcgctgggcctgcagccgcgcgccgcgcgcgcaatggtggccgaagtgctcgac
cagtggggcgcactcgcagtggaaggccacttcaccggccccacgcaatggctgacgtat
caccaattggtgcgtgatggcctggcacgtgtggtcggtgcactgcccggcgaagtggtc
gcgatgaacacgctgagcgtcaacctgcatctgatgatggccagcttttaccgccccacg
cccgagcgcggcgcgatcctgatcgaagccggtgcgtttccgtccgaccgccatgcggtg
gaatcgcaactgcgcctgcatgggctggatccggccacgcacctgatcgaagtggaagcc
gatgagcccaacggtaccttgtcgatggcggcgattgccgaagccatcgcattgcatgga
tcgcgtctggcgttggtgctgtggcccggcatccagtaccgcaccggccaggccttcgcg
ctgggcgacatcgcgcgtttggcgcgcgcgcaaggcgccgcggtgggtttcgatctggcg
catgcggtcggcaatatcccgctgacgctgcacgacgatggcgtggatttcgcggtgtgg
tgccactacaaatatctcaacgccgggcccggtgcggtgggcggttgtttcgtgcacgaa
cgccatgccaacagcgacctgccgcgcatggccggttggtgggggcacgaacagcagacc
cgcttccgcatggacccgcagttcgtgccctcgccaggtgccgaaggctggcagctgagc
aatccgccggtactggcgctggccccgctgcgtgcgtcgcttgatgtgttcgaccaggcc
ggcatgccggcgttgcgtgcgaaatccgaacagctcaccggccatctggaacagctgatc
cacacacgcgtgccgcaggtgctgcagatcgtcaccccgtccgaccctgcgcagcgcggt
tgccagctgtcgctgcgggtggccggcgggcgggcgcaagggcgctcgctgttcgagtat
ctgcagtcggtcggcgtgcttggcgactggcgcgagccggacgtgatccgcatcgcaccg
gtgccgctgtacaaccgcttctgcgatctgcatcggttggtcgagcaggtggaaacctgg
gccgccgcctga

DBGET integrated database retrieval system