KEGG   Xanthomonas hortorum: XJ27_03620Help
Entry
XJ27_03620        CDS       T05082                                 

Definition
(GenBank) nitrate reductase
  KO
K00372  assimilatory nitrate reductase catalytic subunit [EC:1.7.99.-]
Organism
xhr  Xanthomonas hortorum
Pathway
xhr00910  Nitrogen metabolism
xhr01100  Metabolic pathways
xhr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    XJ27_03620
Enzymes [BR:xhr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     XJ27_03620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4 Fer2_BFD
Motif
Other DBs
NCBI-ProteinID: ASW45173
UniProt: A0A248Y6N0
LinkDB All DBs
Position
866417..869215
Genome map
AA seq 932 aa AA seqDB search
MSEGLQPASSGEAVQPHMSSPMHRITRSTCCYCGVGCGVLIHSEHDTNGERIVGIEGDPL
HPANHGRLCSKGLALPQTVASTQGRVLEPELRRHRQAPRAAVSWDQALSHVTNKLAAIIE
EHGPDAVAFYLSGQLLTEDYYVFNKLAKGLLGTNNIDTNSRLCMSSAVTGYKLALGADGP
PTCYEDLELAQTVLFAGSNMAYAHPVLFRRLEAARARNPEIRWIVIDPRRTDTAAMADLH
LAIEPGTDVALFNGMLHHLIWEGLVDARFVAAHTEGFDALKHMLREYTPRMSAEICGISH
EDLVQAAEWFGRSPAALSLYCMGLNQSAHGTDKNLALINLHMATGQIGKPGAGPFSLTGQ
PNAMGGREVGGMATMLAAHREIGNADDRAELERLWNLPAGRLSATAGAPAVQLFERLRAG
TLKAVWIVCTNPVHSMPEVEGIRAALEQAELVIVQDAFSGTDTVPYADVLLPAASWGEKD
GTVTNSERRITRVRKAVDAPGQARADWWIAREVARRLEARLAPASGAGLFAFDTTAQIFD
EQRALTVGRDLDIGGLDYAMLDCGPQQWPFPAGAAHGQARRYTDGVFATSNGRARFHATP
HRKVAEPTSARFPMRLLTGRLRDQWHGMSRSGRVPAAFAHSPEPALRMHPDDATRRGLVA
GELVQIASKRGALVLPLELSDELRSGTVFAAMHWSAQNLSSGGINEVSSPAVDARSQQPE
LKHAAVRVEKAVFGWHLLAARRGNALALQQTLQPLLRDCGYTSLRLHAEPLAEAGGNWAV
LHAACERAPEAQWIDRLVAALQLPSGADVLEYRDLRRGLMRRVGWRMQDGHSHIDGLLLT
AAQPSEANHALLATALAGQAWRGPRLAVFAQTQRTPSDPIVCTCMQVSTSAIHAAIDDGA
DLDQLKQRLGCGSVCGSCVPQLTRLCRQPRLA
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaggtctgcagcccgcatcaagcggcgaggcggtgcagccgcacatgtcctcg
ccaatgcatcgcatcacacgttcgacctgctgctactgcggcgttggctgcggggtactg
atccacagcgaacacgacaccaatggcgagcgcatcgtcgggatcgaaggcgacccgctg
catccggccaatcatgggcggttatgcagcaagggcctggcgttgccgcagacggttgcc
agtacgcaggggcgcgtgctcgaaccggagctgcgtcgtcatcggcaggcgccacgtgcg
gcggtgagctgggatcaggcgttgagccacgtcaccaacaagctggccgcaatcatcgag
gagcatggcccggatgcggtggcgttctatctttccgggcagttgttgaccgaggactac
tacgtcttcaacaagctcgccaagggcttgctcggcaccaacaacatcgacaccaattcg
cgcctgtgcatgtccagcgcggtcaccggctacaagctcgccctgggcgccgacggcccg
ccgacctgttacgaagatctggagctggcgcaaacggtgctgtttgccggcagcaacatg
gcctacgcacatccggtgttgtttcgccggctggaagctgcacgcgcacgcaatcccgag
attcgctggatcgtgatcgatccgcgtcgcaccgacaccgcggccatggccgacctgcac
ctggcgatcgagcccggaaccgacgtcgcactgttcaacggcatgctgcatcacctgatc
tgggagggtctggtggatgcgcgtttcgtggcggcgcataccgagggtttcgatgccctc
aagcacatgctgcgcgaatacaccccgcgtatgagcgccgagatctgcggtatctcgcat
gaggacctggtgcaggcggcggagtggttcgggcgcagcccggcggcgttgtcgctgtat
tgcatgggcttgaatcaatccgcgcatggcaccgacaagaatctggccctgatcaatctg
catatggcgacggggcagatcggcaagccgggtgccgggccgttttcgttgaccggccag
cccaatgcgatgggtgggcgcgaggtcggcggcatggcgacgatgctggcggcgcatcgc
gagatcggcaatgccgacgaccgtgcggaactggaacgcctgtggaacttgcctgccggc
cgcctgagcgccactgcaggcgcgccggcggtgcagttgttcgagcgcctgcgtgccgga
acgttgaaagcggtatggattgtctgcaccaaccccgtgcattcgatgccggaggtggag
ggcatccgcgctgcactggagcaggccgagctggtgatcgtgcaggacgcgttttccggc
accgacaccgtgccctatgccgatgtgctgttgccggcagccagttggggcgagaaggac
ggcacggtgaccaactccgagcgccgcatcacccgcgtgcgcaaggcggtggacgcgccg
ggccaggcgcgtgcggattggtggatcgcgcgcgaagtggcacgccggctcgaagcgcgt
cttgcacctgccagcggcgcaggcttgtttgcgttcgataccaccgcgcagatcttcgac
gagcagcgtgcgctgaccgtgggccgcgatctggatatcggcgggctggattacgcgatg
ctggattgcgggccgcagcaatggccgtttcctgccggtgccgcacacgggcaggcacgg
cgctataccgatggcgtgttcgccaccagcaacggacgcgcgcgtttccatgccacgccg
catcgcaaggtggccgagccgacctcggcacgctttccgatgcggttgctgaccggccgc
ctgcgcgatcagtggcatggcatgtcgcgcagcggacgcgtgcctgcggcgtttgcgcat
agtccggaaccggcgttgcgcatgcatccggacgacgcgacgcgacgcggtctggtcgcc
ggcgaactggtgcagattgcgagcaagcgcggcgcgttggtgttgccgctggaactctcc
gacgaactgcgctcgggcaccgtgttcgccgcaatgcattggagcgcgcagaacctgtcc
agtggcggcatcaatgaagtgagcagcccggcggtggatgcgcgctcgcagcagcccgag
ctcaagcacgcagcggtgcgagtggagaaagccgtattcggctggcatctgctcgcggcc
cggcgcggtaatgcgttggccttgcaacagacgttgcagccgctattgcgcgactgcggc
tatacatcgctgcggctgcatgccgagccgctggcggaggcgggcgggaactgggcggtg
ttgcatgctgcctgcgaacgcgcaccggaggcgcaatggatcgatcgcctggtcgccgcc
ttgcagctgccgtccggcgcggacgtcctggaataccgcgacctgcgccgcggcctgatg
cgccgcgtcggctggcgcatgcaggacggtcacagccatatcgatggcttgctgctcact
gccgcccagcccagcgaggccaatcacgccttgcttgctaccgcattggcaggccaggcg
tggcgtggtccgcggctggcggtgttcgcgcagacgcaacgcacgccgagcgacccgatc
gtgtgcacctgcatgcaggtgtcgacgtctgcgattcatgccgccatcgacgacggcgcc
gatctggatcagctcaaacaacgcctgggctgcggcagcgtctgcggctcctgtgttccg
caactcacccggctgtgccggcaaccacggctcgcctga

DBGET integrated database retrieval system