KEGG   Xanthomonas hortorum: XJ27_05180Help
Entry
XJ27_05180        CDS       T05082                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06178  23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
xhr  Xanthomonas hortorum
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:xhr03009]
    XJ27_05180
Enzymes [BR:xhr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     XJ27_05180
Ribosome biogenesis [BR:xhr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    XJ27_05180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: ASW45434
UniProt: A0A248Y7I4
LinkDB All DBs
Position
1204165..1205793
Genome map
AA seq 542 aa AA seqDB search
MSDTPRKLSLNKLSLKRDSAPEAPKLEERLHKVLAQAGLGSRRALEQRIADGLIKVNGAV
AQTGMSVRSGDKIELDGRSFVASALTEPSRVLIYNKPEGEVTTREDPEGRPTVFESLPAL
KGSRWIAIGRLDINTTGLLLLTTDGELANAMMHPSYEVEREYVVRVRAPEGEDKVSDAII
ERLSRGVLLEDGGAKFDEIERIGGTDSHDWFRVVVKEGRNREVRRLWESQGCQVSRLKRS
RYGKISLPRELLRGQSVEVAQEKVDALRAELKLEEGAPSALTLQPVIGQRRAAKSTVHVS
RDGRSNAYVNGQTSGADEGRELRRFDNPRDDRGGRGRGKPGGFKGGLTVSGEAAARQSQQ
RPFKPRAPGKGDRALPDGNPAAFRSWYVPDGVSTGPSGHRNAGPSGPGTGQARPYAKKGP
GGARPGAGGQGQGRGGAGGGGGQGQSQGQGQGQRKHPYGHPGNAPSFPSDHANPGFSPYG
AARPAAGRPTGARAGGPGGNRGPGGNRGPGGPGGAPRGPGGPGGRPPGGGNRRPPGGGNR
GR
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaccccccgcaagctgtcgttgaacaaactctccctcaagcgcgacagcgcg
cccgaagcgcccaagctggaagagcgcctgcacaaggtgctggcccaggccggcctgggg
tcgcgccgcgcgctggaacagcgcattgccgatggcctgatcaaggtcaatggcgccgtc
gcgcagaccggcatgtcggtgcgcagcggcgacaagatcgagctggacggccgtagtttc
gtcgccagcgcgctgaccgagccctcgcgcgtgctgatctacaacaagcccgaaggcgaa
gtgaccacgcgcgaagatcccgaaggccgcccgaccgtgttcgagtcgctgccggcattg
aagggctcgcgctggatcgcgatcggccgcctggacatcaacaccaccggcctgctgctg
ctgaccaccgacggtgagctggccaacgcgatgatgcatccctcttacgaggtcgaacgc
gaatacgtggtgcgcgtgcgcgcgccggaaggcgaggacaaggtctccgacgccatcatc
gagcgcctgtcgcgcggtgtgctgctggaagacggcggcgccaagttcgacgagatcgaa
cgcatcggcggtaccgactcgcacgactggttccgcgtggtggtcaaggaaggccgcaac
cgtgaagtgcgccgcctgtgggagtcgcaaggctgccaggtcagccgcctcaagcgcagc
cgctacggcaagatctcgctgccgcgcgagttgctgcgtgggcagtcggtggaagtggcg
caggaaaaggtcgacgccctgcgcgccgaactcaagctggaagaaggcgcgccgtcggca
ctgacgctgcagccggtgatcggccagcgccgtgcggccaaatctaccgtgcacgtctcg
cgcgatggccgcagcaatgcctacgtcaatggccagacctccggcgccgacgaaggccgc
gagctgcgtcgtttcgacaatccgcgcgacgatcgtggcggccgtggtcgcggcaagccc
ggcggtttcaagggtggtctcaccgtcagcggcgaggcggccgcacggcagtcgcagcag
cgcccgttcaagccgcgcgcgccgggcaagggcgatcgcgcgttgccggacggcaatccg
gccgcgttccgcagctggtatgtgcccgatggcgtgagcaccggcccgagcggccaccgc
aacgccggcccaagcggtcccggcaccggccaggcccgtccgtacgccaagaagggtccc
ggcggcgcgcgtccgggtgcaggcggccaaggtcagggccgtggcggtgctggcggcggc
ggtggacaaggccagtcgcagggtcaaggccagggtcagcgcaagcatccttacggtcac
ccgggcaacgcaccgagcttcccgtccgaccacgccaacccgggtttcagcccgtatggc
gcggcacgtccggcagctggtcgcccgaccggtgcgcgtgcaggcggcccaggcggcaac
cgtggaccgggcggtaatcgcggtcccggtggcccgggcggcgctccacgtggcccaggt
ggtccgggtggtcgtccgccgggtggcggcaaccgtcggccgccaggtggtggcaatcgc
ggtcgctaa

DBGET integrated database retrieval system