KEGG   Xanthomonas hortorum: XJ27_05990Help
Entry
XJ27_05990        CDS       T05082                                 

Definition
(GenBank) stringent starvation protein A
  KO
K03599  stringent starvation protein A
Organism
xhr  Xanthomonas hortorum
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:xhr03021]
    XJ27_05990
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xhr02000]
    XJ27_05990
Transcription machinery [BR:xhr03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     XJ27_05990
Transporters [BR:xhr02000]
 Other Transporters
  Pores ion channels [TC:1]
   XJ27_05990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ASW45580
UniProt: A0A248Y7S5
LinkDB All DBs
Position
complement(1380128..1380763)
Genome map
AA seq 211 aa AA seqDB search
MATSVRMRNTLTLFSSNDDVLCHRVRLVLAAKGVTYDLVPVDPQNPPEDLIDLNPYHSVP
TLVERDLVLYAASVVSEYLDERYPHPPLMPVDPLSRARLRLAMLRIEHDWVPQVQAIQLG
NKTQAEAGRKRLKELLTASVPLFKASKFFLNPEMSLADCAMAPIIWRLDALEIGLPKDGK
AIEDYGNRIFRNPGFIRSLTDQERKLRDMPG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgagtgtgcgtatgcgaaataccttgactttgttttcgtccaacgatgacgtg
ttgtgccaccgggttcgcttggtcctggcagcgaaaggggtgacctacgacctggtgccg
gtcgacccacaaaatcctcccgaagatctgatcgatctcaatccctatcactcggttccc
accctggtcgaacgcgacctggtgctgtacgccgcatcggtggtcagcgagtacctggac
gagcgctatccgcatccgccgctgatgccggtcgacccgctgtcgcgcgcgcgcctgcgt
ctggcgatgctgcggatcgagcacgactgggtgccgcaggtgcaggccatccagctcggc
aacaagacccaggccgaagccggccgcaagcgcctgaaggaactgctcaccgcatcggtg
cctttgttcaaggccagcaaattctttctcaatccggaaatgagtctggccgattgcgcc
atggcgccgatcatctggcgactggacgcattggagatcggcctgcccaaggacggcaag
gcgatcgaggactacggcaaccggatcttccgcaatcccggcttcatccgcagcctgacc
gatcaggaacgcaaactgcgcgacatgccgggctga

DBGET integrated database retrieval system