KEGG   Xanthomonas hortorum: XJ27_07730Help
Entry
XJ27_07730        CDS       T05082                                 

Definition
(GenBank) MarR family transcriptional regulator
  KO
K15974  MarR family transcriptional regulator, negative regulator of the multidrug operon emrRAB
Organism
xhr  Xanthomonas hortorum
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xhr03000]
    XJ27_07730
Transcription factors [BR:xhr03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    XJ27_07730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 B-block_TFIIIC Rrf2
Motif
Other DBs
NCBI-ProteinID: ASW45865
UniProt: A0A248Y8P9
LinkDB All DBs
Position
complement(1796700..1797200)
Genome map
AA seq 166 aa AA seqDB search
MSSFDPTASRVDHTCVRYPAFPREPAVLVRLIKHLYKRLHTQGSVRLKPYGISPPEYEIL
MMLYGTPEQAITPTEVAEAASEKPANITRLTDQLCEKGLIARGSSPDDRRKIVLTLQPAG
LALIKNLLPDACTLLNAETAGMSEAEQVRLEKLLRKLLDGVDAVEL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtttcgatccaaccgcaagtcgcgtggaccacacttgcgtgcgttacccggcg
ttcccgcgggagccggctgtcctggtgaggttgatcaagcatctctacaagcgattgcat
acgcagggctccgtgcggctgaagccttacggaatcagtccaccggaatacgaaattctg
atgatgctctacggcacgccggagcaggccatcacgcctaccgaagtggccgaagcggcc
agcgagaagccggccaacatcacccggctcaccgatcagctctgcgaaaagggcctgatc
gcgcgcggcagcagccccgacgaccggcgcaagatcgtgctgacgctgcagcctgcaggc
ctggccttgatcaagaatctacttcccgatgcctgcacgttgttaaatgcagaaactgcc
ggcatgagcgaagccgagcaggtgcgcctggagaaattgctgagaaaactgctcgatggt
gtggacgcggtcgagctctga

DBGET integrated database retrieval system