KEGG   Xanthomonas hortorum: XJ27_10985Help
Entry
XJ27_10985        CDS       T05082                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xhr  Xanthomonas hortorum
Pathway
xhr00010  Glycolysis / Gluconeogenesis
xhr00053  Ascorbate and aldarate metabolism
xhr00071  Fatty acid degradation
xhr00280  Valine, leucine and isoleucine degradation
xhr00310  Lysine degradation
xhr00330  Arginine and proline metabolism
xhr00340  Histidine metabolism
xhr00380  Tryptophan metabolism
xhr00410  beta-Alanine metabolism
xhr00561  Glycerolipid metabolism
xhr00620  Pyruvate metabolism
xhr00625  Chloroalkane and chloroalkene degradation
xhr00903  Limonene and pinene degradation
xhr01100  Metabolic pathways
xhr01110  Biosynthesis of secondary metabolites
xhr01120  Microbial metabolism in diverse environments
xhr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XJ27_10985
   00053 Ascorbate and aldarate metabolism
    XJ27_10985
   00620 Pyruvate metabolism
    XJ27_10985
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XJ27_10985
   00561 Glycerolipid metabolism
    XJ27_10985
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XJ27_10985
   00310 Lysine degradation
    XJ27_10985
   00330 Arginine and proline metabolism
    XJ27_10985
   00340 Histidine metabolism
    XJ27_10985
   00380 Tryptophan metabolism
    XJ27_10985
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XJ27_10985
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XJ27_10985
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XJ27_10985
Enzymes [BR:xhr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     XJ27_10985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASW46418
UniProt: A0A248YAB6
LinkDB All DBs
Position
2497677..2499146
Genome map
AA seq 489 aa AA seqDB search
MEALSATLRGIAARGPLGLFIDGQWRASTGDRHVDVIAPHTEERLLRYTEPSSADTDAAV
AAARAAFDSGPWPQLSPPERGVVLKRVAEHLRARMPELAEAWTGQVGATIGFSRRASQQA
PGLFDYYGDLIATHPFVEPRARANGGRVHVVQEPVGVVAAITPWNAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPDGVFNLLPAGREVGEQLIRHPQVDKVSFTG
STQAGRAIGVACAQRLARVGLELGGKSAAIVLDDADLAKVLPSLVPYSMPITGQVCFALT
RVLVPAQRREEILQAYCAALSALKLGDPFAADTGMGPLALGRQLERVQSYIAQGSAEGAR
LVMGGGRPTHLPRGFFIEPTVFAEVTPDMTIAREEIFGPVVSFIDYHDDADLIAKVNASD
FGLHGTVYSEDPERAYRIARRVRSGSHCINGMWVDIEMPFGGFKNSGIGREGGIEGLHAF
LETRTIYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttgtccgcaaccctgcgcgggatcgccgcgcgtgggcctttgggtctgttc
atcgatggtcagtggcgcgccagcaccggcgatcgccatgtcgatgtgatcgcgccgcac
accgaagagcgcctgctgcgttacaccgaaccctcctctgccgataccgatgcagcagtc
gctgctgcgcgtgccgcgttcgacagcggcccctggccacaactgtcgccgcccgaacgt
ggcgtggtgctcaagcgcgttgccgaacacctgcgtgcacgcatgccggaactggccgag
gcctggaccggccaggtcggcgccaccatcggcttcagccgccgcgcctcgcagcaagcg
cccggcctgttcgattactacggcgacctgatcgccactcatccgttcgtggagccgcgt
gcacgcgccaacggtggccgcgtgcatgtcgtgcaagaaccggtcggcgtggtcgcagcg
atcacgccatggaacgccccattggtgctgctctgctacaaggtcgccgccgcattggcc
gccggttgcacggtggtggccaagccctccccggaaacgccgatcgatgcctacatcctg
gccgaatgcatcagcgccgccggtgtccccgatggcgtgttcaatctgttgccggccggt
cgcgaggtcggcgaacagctgatccgtcatccgcaggtggacaaggtgagctttaccggt
tccacccaggcgggccgagcgatcggcgttgcctgtgcgcagcggttagcgcgggtcggg
ctggaactgggcggcaaatccgcagcgatcgtgctcgacgatgccgatctggccaaggtg
ctgcccagcctggtgccctactccatgccgatcaccggccaggtgtgcttcgcgctcacc
cgcgtgctggtgccggcgcagcggcgcgaagagatcctgcaggcgtattgcgcggccttg
agtgcgctcaagctcggcgacccgttcgctgccgataccggcatgggcccgttggcgctt
ggccgccagctcgagcgcgtgcagtcctacatcgcgcaaggcagcgccgagggtgcgcgc
ctggtcatgggtggcggtcgtccgacgcacttgccgcgcggtttctttatcgagccaacg
gtatttgccgaggtgacaccggacatgaccatcgcgcgcgaagagatcttcggcccggtg
gtcagctttatcgattatcacgacgacgccgacctgatcgccaaggtcaatgccagcgac
ttcggtctgcacggcacggtctacagcgaagatcccgagcgcgcgtatcgcatcgcacgc
cgcgtgcgcagcggcagccattgcatcaatggcatgtgggtggatatcgagatgccattc
ggtgggttcaaaaattccggtatcggccgcgaaggcggtatcgaaggcctgcacgcattt
cttgaaaccaggaccatttatctcagttag

DBGET integrated database retrieval system