KEGG   Xanthomonas hortorum: XJ27_16230Help
Entry
XJ27_16230        CDS       T05082                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
xhr  Xanthomonas hortorum
Pathway
xhr00010  Glycolysis / Gluconeogenesis
xhr00620  Pyruvate metabolism
xhr01100  Metabolic pathways
xhr01110  Biosynthesis of secondary metabolites
xhr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XJ27_16230
   00620 Pyruvate metabolism
    XJ27_16230
Enzymes [BR:xhr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     XJ27_16230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ASW47337
UniProt: A0A248YCZ6
LinkDB All DBs
Position
3731199..3732728
Genome map
AA seq 509 aa AA seqDB search
MNALPSTKPLNTDPTSIFKPRYDNFIGGAWVAPASGQYFDNTTPISGKVFTSIARSNAQD
IEAALDAAHAAKEAWGKTSTTDRANVLLKIADRIEQNLELLAYAETWDNGKPVRETLNAD
VPLCVDHFRYFAGAIRAQEGGISEIDSDTIAYHFREPLGVVGQIIPWNFPLLMACWKLAP
ALAAGNCVVMKPAEQTPASILVLMEVIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKIA
FTGENTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGFVLFAFNQ
GEVCTCPSRALIQDSIYDRFMEKALARVAAIKQGNPLDPNTMVGAQASSEQLEKILAYID
IGRQEGAEVLIGGERNTLDGELADGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKDEA
EALAIANDTLYGLGAGVWSRDAARLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgcttccctccaccaagccgttgaataccgacccgacctcgattttcaaaccg
cgctacgacaactttatcggcggtgcgtgggtggcgccggcgagcggccagtacttcgac
aacaccacgccgatcagcggcaaggtgttcacctcgatcgcgcgctccaacgcgcaggac
atcgaagcggcgctggatgcggcgcatgcggccaaggaggcctggggcaagacctccacc
accgaccgcgccaacgtgttgctcaagatcgccgaccgcatcgagcagaatctggaactg
ctcgcctatgccgagacctgggacaacggcaaaccggtgcgcgaaacgctcaacgccgat
gtgccgttgtgcgtggatcacttccgctatttcgccggtgccattcgcgcgcaggaaggc
ggcatttccgagatcgacagcgacaccatcgcctatcacttccgcgaaccgttgggcgtg
gtcgggcagatcattccgtggaattttccgttactgatggcctgctggaaactcgcaccg
gcgctggccgccggcaactgcgtggtgatgaagccggccgagcagaccccggcgtcgatc
ctggtgttgatggaagtgatcggcgatctgctgccgccgggcgtgctcaatgtggtcaac
ggcttcgggctggaggcgggcaagccgctggccagcaacccgcgcatcgccaagatcgcc
ttcaccggcgaaaacactaccggtcggctgatcatgcagtacgccagccagaacctgatt
ccggtgacgctggagctgggcggcaaatcgccgaacatcttttttgccgatgtgatggct
gaagacgacgattttctcgacaaggcggtggagggcttcgtgctgttcgccttcaatcag
ggcgaggtgtgcacctgcccatcgcgcgcgctgatccaggactcgatctacgacaggttc
atggaaaaagcgctcgcacgcgtggccgcgatcaagcaaggcaacccgctcgatcccaac
accatggtcggcgcgcaggcttccagcgagcagctggaaaagattctggcctacatcgat
atcggcagacaggaaggcgccgaagtgttgatcggtggcgagcgcaacacgctcgatggc
gagttggccgatggcttctacgtcaagccgaccgtgttcaaaggccacaacaagatgcgc
gtgttccaggaagagatcttcggcccggtggtgtcggtgaccaccttcaaggacgaggcc
gaggcgctggcgatcgccaacgacacgctttacggcctgggcgccggcgtgtggagtcgc
gatgcggcgcggctgtatcgcatgggccgcgcaatccaggccgggcgcgtgtggaccaat
tgctatcacgcctatccggcgcatgccgcgttcggcggttacaagcagtcgggcatcggc
cgcgagaatcacaagatgatgctcgaccattaccagcagaccaagaatctgctggtgagc
tattcgccgaaggcgttggggttcttctga

DBGET integrated database retrieval system