KEGG   Xanthomonas hortorum: XJ27_16735Help
Entry
XJ27_16735        CDS       T05082                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xhr  Xanthomonas hortorum
Brite
Enzymes [BR:xhr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     XJ27_16735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ASW47424
UniProt: A0A248YDC0
LinkDB All DBs
Position
3863075..3863722
Genome map
AA seq 215 aa AA seqDB search
MRILPATLFLATALVLTACKRDEPAPADPAPAPQAGTPAEAAHGGEHAASMVTEAAATTT
ATAELKPTKGNEVKGTVSFKTVDGALRVTGQLSGLKPNSEHGFHIHEKGDCSAPDGSSAG
GHFNPAQSDHGTVSADPHHGGDMPNITADAQGNASIDGPVSSNVNLGKADQFDIAGHAVI
VHADADDYKTQPTGNAGGRLACGVITTDNAPAATK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattcttcccgcgacgttgttcctggccaccgcgctggtgctgaccgcgtgcaag
cgcgacgaaccggcaccggccgatcccgcacccgcaccgcaggccggcacgccagccgaa
gcggcgcatggtggcgagcatgccgcttccatggtcaccgaagcggcggccactaccacc
gcaaccgccgagctcaagccgaccaagggcaatgaggtgaagggcacggtgagcttcaag
actgtcgacggcgcgctgcgcgtcaccggccagctgagcggcctcaagcccaacagcgag
cacggcttccacatccacgaaaagggcgattgcagcgcaccggacggcagcagtgccggc
gggcatttcaacccggcccaatccgatcacggcaccgtcagtgccgacccgcatcacggt
ggcgacatgcccaacatcaccgccgacgcgcagggcaatgccagcatcgatggcccggtc
tcgagcaacgtcaatctcggcaaggccgaccagttcgatatcgccggccacgccgtgatc
gtgcatgccgacgcggacgactacaaaacccaacccaccggcaacgccggcggccgtctg
gcctgcggtgtgatcaccaccgacaacgcgccggctgcgaccaagtaa

DBGET integrated database retrieval system