KEGG   Xanthomonas hyacinthi: FZ025_04895Help
Entry
FZ025_04895       CDS       T06345                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xhy  Xanthomonas hyacinthi
Brite
KEGG Orthology (KO) [BR:xhy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FZ025_04895 (ahpF)
Enzymes [BR:xhy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FZ025_04895 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 AlaDh_PNT_C Glutaredoxin DAO K_oxygenase Thi4 FMO-like Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: QGY76033
LinkDB All DBs
Position
1056078..1057667
Genome map
AA seq 529 aa AA seqDB search
MLDADLKTQLKAYLERVVRPIHITASVDDGAKSREMLDLLEDLVLLSDQISLDVHRDSAE
RTPSFALGSPGHAIHLRFAGLPLGHEFTSLVLALLQVGGHPSKATAEVIEQVRNLPGEYV
FETYFSLSCQNCPDVVQALNLAAVLNPNIKHVAIDGALFQDEVEARQIMSVPTVYLNGAV
FDQGRMSLEQIVAKLDTGAGKRDAAAIAAKAPFDVLVIGGGPAGAAAAIYAARKGIRTGV
AAERFGGQVLDTMAIENFISVQETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGTDG
LVEIRLGNGASLKSRSVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDAKLRADEVLQRKLRSLGNVDIIVNAQSTEVSGDG
HKVTGLVYKDRVGGDSHRVALEGIFVQIGLLPNTEWLQGTVALSPRGEIVVDDRGQTSLP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRSSAPVDSAVAEAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccgatctgaaaacccagttgaaggcttacctggagcgggtcgttcggccc
atccacatcaccgcgtcggtggacgacggcgccaagtcgcgcgagatgctcgatctgctc
gaagacctggtgctgctgtcggaccagatcagcctggacgtgcaccgcgacagcgccgag
cgcaccccgtcgttcgcgctgggcagccccggccacgccatccacctgcgcttcgccggg
ctgccgctgggccacgagttcacctcgctggtgctggcgctgctgcaggtcggcgggcac
ccgtccaaggccaccgccgaggtcatcgagcaggtgcgcaacctgcccggcgagtacgtg
ttcgaaacctatttctcgctgtcctgccagaactgcccggacgtggtgcaggcgctgaac
ctggccgcggtgctgaacccgaacatcaagcacgtggcgatcgacggcgcgctgttccag
gacgaggtggaggcgcggcagatcatgtcggtgcccaccgtgtacctcaacggcgcagtg
ttcgaccagggccgcatgagcctggagcagatcgtggccaagctcgataccggcgcgggc
aagcgcgatgccgcggccatcgcggccaaggcgccgttcgacgtgctggtgatcggcggc
ggcccggccggcgcggcggcggcgatctatgccgcgcgcaagggcatccgcaccggcgtg
gccgccgagcgcttcggcggccaggtgctggacaccatggcgatcgagaacttcatttcg
gtgcaggagaccgaaggcccgaagatggccgcggcgctggagcagcacgtgcgccagtac
gacgtggacatcatgaacctgcagcgcgccgagcagctgattccggccggcaccgacggc
ctggtcgagatcaggctgggcaacggcgcgtcgctgaagagccgtagcgtgatcctgtcc
accggcgcgcgctggcggcagatgaacgtgcccggcgaggaccagtaccgcaacaagggc
gtggcctattgcccacattgtgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattccggcgtggaagcggcgatcgacctggccggcatcgtcagccacgtc
accctgctcgagttcgacgccaagctgcgcgccgacgaagtcctgcagcgcaagctgcgc
agcctgggcaacgtggacatcatcgtcaacgcgcagagcaccgaggtcagcggcgacgga
cacaaggtcaccggcctggtctacaaggaccgcgtcggcggcgacagccaccgcgtggcg
ctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgagtggctgcagggcacg
gtggcgctgtcgccgcgcggcgagatcgtcgtcgacgaccgcggccagacctcgctgccc
ggcgtgttcgccgccggcgatgcgaccacggtgccgtacaagcagatcgtcatcgccatg
ggcgaaggctccaaggcggcgctgagcgcgttcgaccacctgatccgcagcagcgcgccg
gtcgacagcgcggtcgccgaagcggcctga

DBGET integrated database retrieval system