KEGG   Candidatus Xiphinematobacter sp. Idaho Grape: AMD24_00356Help
Entry
AMD24_00356       CDS       T04108                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
xii  Candidatus Xiphinematobacter sp. Idaho Grape
Pathway
xii00473  D-Alanine metabolism
xii00550  Peptidoglycan biosynthesis
xii01100  Metabolic pathways
xii01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xii00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AMD24_00356 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AMD24_00356 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AMD24_00356 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xii01011]
    AMD24_00356 (ddlB)
Enzymes [BR:xii01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AMD24_00356 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:xii01011]
 Precursor biosynthesis
  Amino acid ligase
   AMD24_00356 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 RimK ATP-grasp ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: ALJ56537
UniProt: A0A0P0FYY0
LinkDB All DBs
Position
380135..381073
Genome map
AA seq 312 aa AA seqDB search
MRNYQRLLQVDRSSLKGMHFVVLKGGPGKERAISLQSGASVADALRSRQYYVTEIDVTKD
LDLPKGTDLVFNTIHGTFGEDGCLQDLLEERGVPFTGDGAAGCRLAFDKILAKRRFVRAG
IPTSPFEVLSSGEQPSFAPPFVLKPPCQGSSIGVHVVHNRQQIPLAMENVLKYGDKVLLE
SFFLGRELTVSVVANTVLPIVEIVSTNGVYSYENKYVSGRSEYFAPARLSSDHTAATMDT
ALAAHQALGLQLCSRVDILLSEEGRLNVLEVNTIPGMTPFSLMPRAAAAIGIDLSLLCEI
IAVISLQKWKKA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagaaattaccaacgccttttacaagtagaccgctcttccctgaaagggatgcatttt
gttgttctcaagggcggtcctggaaaagagcgggcaatctctctgcaatcgggtgcctcg
gtagcagatgctttgcgctcgcgacagtactatgttaccgagatcgatgtcaccaaagac
ctagacttacctaagggcacagatcttgtttttaatacgattcatggaacatttggggag
gacggttgcttacaggatctccttgaggaaagaggagttccgtttactggagatggagct
gcaggctgccggctggcattcgacaaaatccttgctaaaagacggtttgttagagctgga
atccctacgtctccctttgaggtactgtcttctggagaacagccttcctttgcaccaccc
tttgtacttaagcccccctgccaagggtcttcgatcggcgtacatgtagtgcataaccgg
caacaaatacccttagctatggaaaatgtcctgaaatacggcgacaaggtcctgctagag
tccttttttttaggtagggagcttactgtgagcgttgttgcgaacacggtgcttccaata
gttgagattgtatccacaaatggagtatacagctacgaaaacaaatatgtgtctgggaga
tctgagtatttcgcaccagcacgcctcagcagtgatcataccgcagcaactatggataca
gctctagcagcccatcaagcgcttggattacaactttgctcccgtgtagacattcttctt
agcgaggaaggaagattgaatgtcttggaagtcaacactatccctggcatgacacccttt
agccttatgccacgggcagccgcagcaattgggatcgatttatccttactctgtgagatc
atagctgtaatttccctgcaaaagtggaaaaaagcgtga

DBGET integrated database retrieval system