KEGG   Candidatus Xiphinematobacter sp. Idaho Grape: AMD24_00416Help
Entry
AMD24_00416       CDS       T04108                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
xii  Candidatus Xiphinematobacter sp. Idaho Grape
Pathway
xii00220  Arginine biosynthesis
xii00250  Alanine, aspartate and glutamate metabolism
xii00270  Cysteine and methionine metabolism
xii00330  Arginine and proline metabolism
xii00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xii00401  Novobiocin biosynthesis
xii01100  Metabolic pathways
xii01110  Biosynthesis of secondary metabolites
xii01130  Biosynthesis of antibiotics
xii01210  2-Oxocarboxylic acid metabolism
xii01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xii00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMD24_00416
   00270 Cysteine and methionine metabolism
    AMD24_00416
   00220 Arginine biosynthesis
    AMD24_00416
   00330 Arginine and proline metabolism
    AMD24_00416
   00350 Tyrosine metabolism
    AMD24_00416
   00360 Phenylalanine metabolism
    AMD24_00416
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMD24_00416
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    AMD24_00416
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xii01007]
    AMD24_00416
Enzymes [BR:xii01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     AMD24_00416
Amino acid related enzymes [BR:xii01007]
 Aminotransferase (transaminase)
  Class I
   AMD24_00416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: ALJ56591
UniProt: A0A0P0GG35
LinkDB All DBs
Position
complement(449483..450649)
Genome map
AA seq 388 aa AA seqDB search
MDISSRLKELAPSLTLAIDSKSKAMKASGIDIYGFGTGEPDFDTPEHIKAAAVSALEEGC
TKYTTSSGLFELRKAISEKFRLDNHLEYNPDSQIVVSNGAKQSCYNAIMACIEEGDEVII
PAPYWLSYLEMVRLAGGIPVVVPTREESAWKLTASEFENAMTPKTKMIIVNSPGNPSGSV
YTVEELHAISKVAVEEGIYILSDEIYEKLIYDGAEHVSIASLTSEAYGLTITVNGFSKAY
AMTGWRLGYLGAPEPIACAVDSIQSHSTSNPCSFSQRGAIAALKGSQQCVADMREELNLR
RKYVLSRISKIPRVTTVIPRGAFYVLINIGQLGLGSQNFVDRLLSKTNVVAIPGIAFGND
RTIRISYAASMDIIKTGLDRFEEFCQMV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggatatctcgtcccgccttaaagaactagctccgtctctcactcttgctattgatagt
aagtctaaagctatgaaagcctcaggcatcgacatttatggttttggtaccggcgagcct
gactttgacactccagagcatattaaggctgctgctgtttctgctttggaggagggatgc
actaagtacaccactagttctgggctttttgagctacgcaaggccatttccgaaaaattt
cggctagacaaccatctagaatacaaccctgacagtcagatcgtagttagcaacggtgcc
aagcaatcctgttataatgccatcatggcttgcattgaagaaggcgatgaagtgatcatc
ccggccccctattggttgagctatctggaaatggttcggctagcaggcggtatacccgtt
gtggttcctaccagagaagaaagcgcatggaaacttactgcttcggagtttgagaacgct
atgacgcctaaaacaaaaatgatcattgtaaactcgccgggtaatccatcgggctctgtc
tataccgttgaagaattgcatgcaatttctaaagtagctgtggaagagggaatttatatt
ctctcggatgagatctacgagaaacttatttatgacggcgccgagcatgtaagcatcgct
tcgctgacttcagaagcatacggactaactatcactgtcaacggcttcagtaaagcctat
gctatgaccggttggcgtctcggctatttgggagcccctgaaccaatagcctgcgcagtt
gattccatacaaagtcacagcacttctaatccttgctccttttctcagagaggagctatc
gctgcattgaagggcagtcagcaatgtgtagctgatatgcgggaagagcttaatctccgt
agaaaatatgtactaagccgtatttctaaaatccctcgggtgacaaccgttatacctcga
ggtgctttttatgtgcttatcaacattggtcaactaggattaggttctcaaaattttgta
gatcgcctgctaagtaagacaaatgtcgttgcaattccaggaattgcctttggaaatgat
cgaactatccggattagctatgctgccagtatggatataattaaaacaggattggatcgt
tttgaggagttctgtcagatggtctaa

DBGET integrated database retrieval system