KEGG   Candidatus Xiphinematobacter sp. Idaho Grape: AMD24_00599Help
Entry
AMD24_00599       CDS       T04108                                 

Gene name
treS
Definition
(GenBank) Trehalose synthase/amylase TreS
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
xii  Candidatus Xiphinematobacter sp. Idaho Grape
Pathway
xii00500  Starch and sucrose metabolism
xii01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMD24_00599 (treS)
Enzymes [BR:xii01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AMD24_00599 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AMD24_00599 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: ALJ56766
UniProt: A0A0P0FZH6
LinkDB All DBs
Position
631528..634806
Genome map
AA seq 1092 aa AA seqDB search
MERDPPWFKTAVIYELHVRSFCDSTADGVGDFQGLCKRLGYLEDLGITAIWLLPFYPSPL
HDDGYDISDYLSVNPSYGTLDDFCNFLAAAHRRRLHVITELVLNHTSDQHPWFQRSRLAP
PGSVERDFYVWSDTTERYEDARVIFSDFEKSNWSWDPVVQAYYWHRFYFHQPDLNFDNPS
VQEAVFNVVNFWLGLGVDGLRLDAVPYLFERESTSCENLPETHAFLRRLRQHVDEKFPGR
MLLAEANQWPEDAAAYFGAGDECHMEFHFPLMPRLFMALQMEDRFPLTDIFDQTPAIPEN
CQWAIFLRNHDELTLEMVSDEERDYMVRLYAEDIRARINLGIRRRLAPLLGNNRRKIELM
KSLLLSLPGTPILYYGDEIGMGDNFYLGDRNGVRTPMQWSADRNAGFSRANPQQLFLPII
IDPEFHYETVNVDVQRRNLSSLFWWMRRILGIRQKHPAFSLGGIQFLSTENSKVLAYLRR
YKEDQVLLVVANLSRYSQAVSLDLSEFCDRFPEELFGNTRFPIISNLPYLFTLGPHGFYW
LQLHPLSVEEEGVLTENAPPLLTEAAEWTPKLHHALERTILPHYMQKCRWFGEKQSALRK
IRIMESFSPKEDPYTQILLIEVAFTQGHTAIYVVPLTIRNKDTSDISSHSTVASFASGEK
LLDALCVQEVRQHFLNLIAQKQTWRCGTSRLFGIGEDICPEPSLSRLFGSEQSNSSLVFN
EQFNLKLLRRYEAGHNPDADLLRALGEVGFSHVPRYCGEIRYTGSRQQGTIALLTAYVPN
QGDAWVYTLDSLGRFFEGALAAPSLEEGNKMLPELMAGYPERVYQLGLRTGELHRCLATL
PGTNFTPEPFTNLYQRSLYQTLRSLARRTELDLASKTPYLPESLQVQAKSWIAATPRLLA
FYARLLGTKISAKKIRGHGDYHLGQVLNTGKDFVILDFEGEPCRPLGERLLKRPALVDVA
GMLRSFDYAVQSALLAIERQEDHIRLAPWCDLWKNHITSAFLEGYLAGVAGAAFLPRTEK
DFTFLLKVFLLDKALYEIWYELSYRPDLLGIPLCSACQMLQAVDEWGGVITETFNRFTEA
VRAEDAAEKAPE
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
atggaacgagatccaccgtggtttaagactgcagttatctacgaactgcatgtgcgttcg
ttctgcgacagcacagccgacggagtcggtgacttccaggggctatgtaaaaggttagga
tatttggaggatctaggaataacggctatttggcttcttccattctacccatcgccttta
catgacgatggttatgatatctccgattatctgtcagtgaatccaagctacggtacactg
gatgatttctgtaattttttagcagcagcccatcgacgaaggttgcacgtcattacagag
cttgttctgaaccatacatcggatcaacatccctggttccagcgttcacgtttggcaccc
cctggatcagttgaaagagatttctatgtttggagtgatactactgaacgttatgaggat
gcacgtgtcatttttagtgatttcgaaaagtccaactggtcttgggatccagtggtgcaa
gcttattattggcatcggttctattttcatcagccggacctaaactttgacaatccctcc
gttcaagaggcggtcttcaatgtagtaaacttctggttggggttgggagttgacgggtta
aggttggatgccgttccgtatctctttgaacgggagagcacctcgtgtgagaatttgcca
gaaacacatgcctttcttcggcgcctgcgtcagcacgtggatgaaaagttccccggacgt
atgctcctggcggaagctaaccaatggccagaagacgcagccgcatattttggggcagga
gatgagtgtcatatggaattccactttccccttatgccacggctctttatggcgttacag
atggaagaccgctttccactaactgacattttcgatcagacccctgctattccagaaaat
tgccagtgggccatttttcttcgtaaccacgacgagttgacgttagagatggtttctgat
gaggaaagggattacatggtgcgtctttatgcagaggatatccgggcccgtattaacttg
ggcatccgtcgccgtttagctcccttgctgggaaacaatcgccgtaagatcgaattgatg
aaatcccttctgctttcactgcctggcactcccattttgtactatggagacgaaatcggt
atgggagataatttctatttgggagaccgtaatggagtacgcacgccgatgcaatggagc
gccgaccgcaatgctgggttttcacgcgctaacccccagcagctatttctacctattatc
atagatcctgagtttcactatgagacggtgaacgtagatgtgcaaagaaggaatctttct
tcactcttctggtggatgcggcgcatcttaggaattcgccaaaagcatccggcattttcc
cttggaggtatccaatttctctccacagagaattctaaggtattagcctatctccgccgg
tataaagaggatcaggtcttacttgtggtagccaacctctcacgttattcccaggcggtt
tccttggatctttctgaattctgcgaccgatttccggaggagctttttggcaacacacga
ttccctatcattagcaatcttccttatctttttactcttggaccacatgggttttattgg
ttgcagctacaccccctttctgtagaagaggaaggagtgttaactgaaaatgctccccca
ctgcttacggaggcggctgaatggacgccaaagctccaccatgcgctagagcgcacaatt
ctaccgcactatatgcaaaagtgccgctggtttggggaaaaacaatcggcgttacggaag
attcgcattatggagagcttttccccaaaagaagatccgtacacgcaaatcctcttgata
gaggtggcctttacgcaaggacacaccgctatttatgtagttccactgaccatcagaaat
aaggacactagcgacatcagctcccactccactgtagctagcttcgcaagcggtgaaaag
cttttggatgcactgtgtgtccaagaggtgcggcaacattttctcaatctcatcgcacaa
aaacaaacatggcgctgtggaacttcccggcttttcggcataggagaggatatttgtcca
gaaccttccctctcccgattgtttggaagtgaacaatctaattcatcactagtctttaat
gaacaatttaatttgaagcttctacgccgatatgaagctggtcacaaccctgatgccgat
ctccttcgagcattgggagaagtggggttttcacatgtgccacgctactgcggtgaaata
cgctacacgggcagcaggcaacagggaactattgcattactcactgcttatgttccaaac
caaggagacgcctgggtatacaccctggactcacttggacgcttctttgagggtgcactc
gcagcgccatctctagaagagggaaacaaaatgcttccagaacttatggccggttatcca
gagcgagtgtaccaacttggcctgcgcacaggcgagcttcaccgatgcttagcaacactc
ccagggacaaattttacaccagaaccttttactaatctttaccagcgttccctttaccaa
acattgcgcagcctagcacgccggactgaattagacttggccagcaagaccccttatctt
ccggaatcccttcaggtgcaagctaaaagttggattgcagcaacaccccgcctgcttgca
ttttacgcaaggctcctcggaacaaagatatctgcgaaaaaaattcgtggccacggggac
taccatctgggtcaagtgcttaataccggcaaggattttgttatcctagacttcgagggg
gagccgtgtcgtccgctcggagaacggttgctcaagcgccccgcattggttgatgttgct
ggtatgctacgctcgtttgattatgctgtgcaaagtgcattgctggccatcgaacgccag
gaggatcacatccggcttgctccctggtgtgatctttggaaaaaccacattacatccgcg
ttcctggaaggatacttggctggcgttgctggagccgcttttctccctcggacagagaaa
gattttacttttcttctcaaggtttttcttctcgacaaggcactctatgaaatctggtat
gaactgagttaccgtcctgaccttctcggcataccactctgttctgcctgtcagatgctt
caagcagttgatgaatggggaggggttattacagagacctttaaccgcttcactgaagca
gtgagggcagaagacgctgctgaaaaggctccggagtag

DBGET integrated database retrieval system