KEGG   Xenopus laevis (African clawed frog): 100036863
Entry
100036863         CDS       T01010                                 

Gene name
rassf1.L, rassf1
Definition
(RefSeq) Ras association (RalGDS/AF-6) domain family member 1 L homeolog
  KO
K09850  Ras association domain-containing protein 1
Organism
xla  Xenopus laevis (African clawed frog)
SSDB
Motif
Pfam: Nore1-SARAH RA
Other DBs
NCBI-GeneID: 100036863
NCBI-ProteinID: NP_001090617
Xenbase: XB-GENE-866377
UniProt: A1L2J1
LinkDB
Position
4L
AA seq 273 aa
MGKGDKDTTAFERTWDSTSSSGYCSQEESDPELELFYTARTSLFPRRTPARPLDEKPEKQ
PQALSKAEIDQKIKNYNSQIKSNLFMSLNKDGSFTGFIKVQLKLIRPVSVPASKKPSCLQ
DRKGSVRSQPVKRRTSFYLPKDASKHLHLSSRTPASEVIQALLRKFTVLDNPRKFALFER
AEQGGQVSLRKLTDDEEPLKLRLFSGPCEKTLSFVLKENETGEVNWDAFSMPELHNFLRI
LQREEEEHMRQIVQRYTRCREKMQEALASRTPG
NT seq 822 nt   +upstreamnt  +downstreamnt
atggggaagggagacaaggacacgacagctttcgaaaggacttgggacagcacctccagc
agtggctactgcagtcaggaggagtccgacccggagctggagctcttctatactgcgcgg
acctctctcttcccacggaggactccagctcggcccctggatgaaaagccagaaaagcag
ccacaggccctgagcaaggcagagatagatcagaaaataaagaattataattctcagata
aagagcaatctcttcatgagcctgaataaggacggctcgtttaccggattcattaaagtt
cagctgaagcttatccggcccgtttctgtcccagcttccaagaagccttcatgtttgcag
gatcggaaaggtagcgtacgctctcagccggtcaaacgcaggacctccttctaccttccc
aaagatgcttcaaagcacctgcatctgagttcaaggacgccagctagtgaggtcattcag
gctctgctgcggaagttcactgtgctcgataaccccaggaagttcgctctgtttgaaagg
gcagaacagggtggacaagtgtccttgaggaagttaacggatgacgaggagcctctgaag
ctgcgtcttttctcaggaccatgtgagaaaactttgagttttgtgcttaaggagaacgag
acaggagaagtcaattgggatgcattcagcatgccggagctgcacaatttcttgcgcatt
ctgcagcgtgaggaagaagagcacatgcgtcagattgttcagcgttacaccaggtgccgg
gagaagatgcaggaggcactggcatcgcgcacacctggctga

DBGET integrated database retrieval system