KEGG   Xenopus laevis (African clawed frog): 100036910
Entry
100036910         CDS       T01010                                 

Gene name
casp3.L, Apopain, CASP-3, caspase-3, xCPP32
Definition
(RefSeq) caspase 3 L homeolog
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100036910 (casp3.L)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100036910 (casp3.L)
   04115 p53 signaling pathway
    100036910 (casp3.L)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100036910 (casp3.L)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100036910 (casp3.L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xla01002]
    100036910 (casp3.L)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     100036910 (casp3.L)
Peptidases and inhibitors [BR:xla01002]
 Cysteine peptidases
  Family C14: caspase family
   100036910 (casp3.L)
SSDB
Motif
Pfam: Peptidase_C14 Nudix_N
Other DBs
NCBI-GeneID: 100036910
NCBI-ProteinID: NP_001091155
Xenbase: XB-GENE-17335907
UniProt: A1L2P4
LinkDB
Position
1L
AA seq 235 aa
MEESQNGVQYGEDTADAKTYFTTQQISLQNADLKEMERKTKFAHLFKYRTDYPEMGVCLI
INNKNFHSSTSMTVRNGTDVDARRLHETFTSLGYKVKVLNDQRCNDIFGHLKKMSEEDHS
KRSSFACAILSHGEDGLIYGVDGPIPVKNLTDLFRGDRCKTLVGKPKIFFIQACRGTELD
SGIETDSGSEPGEETHRIPVEADFLYAYSTVPGMRILALQHIYGLKGTYMYYLNG
NT seq 708 nt   +upstreamnt  +downstreamnt
atggaagaatcccagaatggtgtacaatatggcgaagatacagcagatgcaaaaacatat
tttacaactcaacaaataagccttcaaaatgctgatctaaaagaaatggaaagaaaaact
aagtttgctcatctcttcaagtacagaacagattacccagagatgggagtttgcctcatc
attaacaataagaactttcattcatctacaagcatgaccgtacgaaatggaactgatgtg
gatgctcgcaggttacatgaaactttcacaagtttaggatacaaagtaaaagttttgaat
gatcaacggtgtaatgacatatttggacatttgaagaaaatgtctgaggaagatcatagc
aagagaagttcctttgcttgtgctattttgagccacggagaggatggtttaatttatgga
gttgatggtcctataccagtaaaaaatctaacggatctcttcagaggagaccgatgcaag
actcttgtgggaaagcccaaaatattcttcatccaggcatgcaggggaacagaactagat
tcaggcattgaaacagacagtggcagtgaaccaggggaagagacccatcggattccagtg
gaggccgacttcttatatgcctattctacagttcctggtatgagaattttggctcttcag
cacatatatggtttgaagggaacatatatgtactatttaaatggttaa

KEGG   Xenopus laevis (African clawed frog): 397720
Entry
397720            CDS       T01010                                 

Gene name
casp3.S, casp3, xcpp32
Definition
(RefSeq) caspase 3 S homeolog
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04115  p53 signaling pathway
xla04210  Apoptosis
xla05132  Salmonella infection
xla05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397720 (casp3.S)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    397720 (casp3.S)
   04115 p53 signaling pathway
    397720 (casp3.S)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    397720 (casp3.S)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    397720 (casp3.S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xla01002]
    397720 (casp3.S)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     397720 (casp3.S)
Peptidases and inhibitors [BR:xla01002]
 Cysteine peptidases
  Family C14: caspase family
   397720 (casp3.S)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 397720
NCBI-ProteinID: NP_001081225
Xenbase: XB-GENE-865327
UniProt: P55866
LinkDB
Position
1S
AA seq 282 aa
MEESQNGVKYGGDATDAKEYFTIQPRSLQNCDLKDIERKTKFAHLQNYRTNYPEMGMCLI
INNKNFHSSNMAVRNGTDVDALKLHETFTGLGYEVMVCNDQKSSDIIGRLKKISEEDHSK
RSSFVCAILSHGEEDGSICGVDVPIHIKNLTDLFRGDRCKTLVGKPKIFFIQACRGTELD
SGIETDSCSEPREEIQRIPVEADFLYAYSTVPGYCSWRDKMDGSWFIQSLCKMIKLYGSH
LELIQILTCVNHMVALDFETFHAKKQIPCVVSMLTKSFYFFK
NT seq 849 nt   +upstreamnt  +downstreamnt
atggaagaatcccagaatggtgtaaaatacggaggagatgcaacagatgcaaaagaatat
tttacaattcaaccacgaagcctgcaaaactgtgacctaaaagacatagaaagaaaaact
aagtttgctcatctccagaattacagaacaaattacccagagatgggaatgtgcctcatc
attaacaataagaactttcattcatcaaacatggccgtacgaaatggaactgatgtagat
gctctcaagttacatgaaactttcacaggtttaggatacgaggtaatggtttgcaatgat
caaaagtctagtgacatcattggacgtttgaagaaaatatctgaggaagatcacagcaag
agaagttcctttgtatgtgctattctgagccatggagaggaggatggttcgatctgtgga
gttgatgttcctatacatataaaaaatctaacagatcttttcagaggagaccgatgcaag
actcttgtgggcaaacccaaaatattcttcatccaggcatgcaggggaacagagcttgat
tcaggcattgaaacagacagttgcagtgaaccacgggaagagatccagcgtattccagtg
gaggccgacttcttatatgcctattctactgtccccggctactgctcatggagagacaaa
atggatggttcctggttcatccagtctttgtgcaaaatgataaaattatatggatcacat
cttgaacttattcagattctgacctgtgtaaatcatatggtagctctagactttgagact
tttcatgcaaagaaacaaattccttgtgttgtgtccatgctcacaaaatcattttacttc
tttaagtaa

DBGET integrated database retrieval system