KEGG   Xenopus laevis (African clawed frog): 100037065
Entry
100037065         CDS       T01010                                 

Gene name
siva1.L, cd27bp, siva, siva-1, siva-2, siva1, siva2
Definition
(RefSeq) SIVA1, apoptosis-inducing factor L homeolog
  KO
K22744  apoptosis regulatory protein Siva
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100037065 (siva1.L)
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 100037065
NCBI-ProteinID: NP_001091260
Xenbase: XB-GENE-5854269
UniProt: A1L1C4
LinkDB
Position
8L
AA seq 163 aa
MPKRSYPFDSVSPLQLKTHVGEKELCQGVAGDTLMRDIFEKTKMLLFKGAKAVVGKQEHQ
RENGQDVSVPELPSGQTVIGHDGKLCRNTQLRKSTLTGVSKACSSCVRSVAAKETCSQCE
RYVCKQCCKVCSCCSAIICSFCTDVDHDNGEGLFCSACSVFEA
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcccaagcgctcgtacccgtttgacagcgtttctcccttacagctcaagactcatgtt
ggtgagaaggagttgtgccagggtgtagccggtgacactctcatgcgggacattttcgaa
aagaccaagatgttgttgttcaaaggagctaaagccgttgtgggaaaacaagagcaccaa
cgtgaaaatgggcaggacgtttctgttcctgagctcccatcaggacagactgttattgga
catgatggcaaactgtgcaggaacactcagttgcgcaaatctaccctgacaggggtatcc
aaagcctgttcttcctgtgtcagatctgttgctgccaaagaaacctgctcacagtgtgaa
cgctatgtttgtaaacagtgctgcaaggtatgcagctgttgctctgcaatcatctgctcc
ttctgcacagatgttgaccatgacaacggtgaagggttgttctgctctgcctgttctgtg
tttgaagcgtaa

KEGG   Xenopus laevis (African clawed frog): 100049128
Entry
100049128         CDS       T01010                                 

Definition
(RefSeq) uncharacterized LOC100049128
  KO
K22744  apoptosis regulatory protein Siva
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100049128
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 100049128
NCBI-ProteinID: NP_001091429
UniProt: A4FVE4
LinkDB
Position
8S
AA seq 163 aa
MPKRSYPFDGVSPLQLKTHVGDKELSQGVAGDTLMWDIFEKTKMLLFKGAKAVLGNKEHQ
SENGQEISLPELPSGQTVIGQDGKLCRNTQSHTSTPTGVSKACSSCVRSVADQETCSQCE
RYVCNECCKECGCCSAIICSFCIEVDHDNGDGLFCSACSVFEA
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcccaagcgctcgtacccgtttgatggcgtctctcccttacaactcaagactcatgtt
ggagacaaggagctgagccagggtgtagccggtgacacactgatgtgggacatttttgaa
aagactaagatgttattgttcaagggagctaaagccgttctgggaaataaagagcaccaa
agtgaaaatggccaagaaatttctcttcccgaactcccatctggacagactgttattgga
caagatggcaaactgtgcaggaacactcagtcacacacatctactccgacaggagtttcc
aaagcctgttcttcctgcgtcagatctgttgctgaccaagaaacctgctcacagtgtgaa
cgttatgtttgcaatgagtgctgcaaggaatgcggctgttgctctgcaatcatctgctcc
ttctgcatagaagttgaccatgacaacggtgacggattgttttgctctgcctgttctgtg
tttgaagcgtaa

DBGET integrated database retrieval system